Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Caspase-12 (Casp12), partial

This Recombinant Mouse Caspase-12 (Casp12), partial spans the amino acid sequence from region 1-92aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Caspase-12 (CASP-12) (EC 3.4.22.-)

UniProt

O08736

Expression Region

1-92aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAARRTHERDPIYKIKGLAKDMLDGVFDDLVEKNVLNGDELLKIGESASFILNKAENLVENFLEKTDMAGKIFAGHIANSQEQLSLQFSNDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR7E104P sgRNA CRISPR Lentivector (Human) (Target 1)
K1538202 1.0 µg DNA

OR7E104P sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Vorsetuzumab ELISA Kit
E55K0526 96 Tests

Vorsetuzumab ELISA Kit

Sign In for Pricing
View Details
CD Markers CD 176 / T-antigen
EBS-CD-056 100 μg

CD Markers CD 176 / T-antigen

Sign In for Pricing
View Details
Squamous Cell Carcinoma Antigen 1 (CPTC-SERPINB3-2), CF568 conjugate, 0.1mg/mL
BNC682250-500 1x 500 µL

Squamous Cell Carcinoma Antigen 1 (CPTC-SERPINB3-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRNAG31 Recombinant Protein (Human)
RP104174 100 µg

TRNAG31 Recombinant Protein (Human)

Sign In for Pricing
View Details
Nipal2 ORF Vector (Rat) (pORF)
ORF071320 1.0 µg DNA

Nipal2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details