Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Pro-neuropeptide Y (Npy), partial

This Recombinant Mouse Pro-neuropeptide Y (Npy), partial spans the amino acid sequence from region 29-64aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pro-neuropeptide Y [Cleaved into, Neuropeptide Y (Neuropeptide tyrosine) (NPY), C-flanking peptide of NPY (CPON) ]

UniProt

P57774

Expression Region

29-64aa

Tag

N-terminal hFc-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Vein Smooth Muscle Primary Cells
CC7F987 5x 10^5 Cells/Vial

Monkey Vein Smooth Muscle Primary Cells

Sign In for Pricing
View Details
Anti-FBXO32 Rabbit Monoclonal Antibody
MA2578-.1 100 µL

Anti-FBXO32 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SPATA18 Protein Vector (Human) (pPB-N-His)
PV132911 500 ng

SPATA18 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Human Kinesin light chain 3 (KLC3)
orb1649898-01 20 µg

Recombinant Human Kinesin light chain 3 (KLC3)

Sign In for Pricing
View Details
Recombinant Human Kinesin light chain 3 (KLC3)
orb1649898-02 100 µg

Recombinant Human Kinesin light chain 3 (KLC3)

Sign In for Pricing
View Details
Recombinant Human Kinesin light chain 3 (KLC3)
orb1649898-03 1 mg

Recombinant Human Kinesin light chain 3 (KLC3)

Sign In for Pricing
View Details