Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Pro-neuropeptide Y (Npy), partial

This Recombinant Mouse Pro-neuropeptide Y (Npy), partial spans the amino acid sequence from region 29-64aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pro-neuropeptide Y [Cleaved into, Neuropeptide Y (Neuropeptide tyrosine) (NPY), C-flanking peptide of NPY (CPON) ]

UniProt

P57774

Expression Region

29-64aa

Tag

N-terminal hFc-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PC4/SUB1 Rabbit Polyclonal Antibody (HRP)
orb2616951 100 µg

PC4/SUB1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Tetraethylurea, 98.0 +%
242273-01 25 mL

Tetraethylurea, 98.0 +%

Sign In for Pricing
View Details
Tetraethylurea, 98.0 +%
242273-02 100 mL

Tetraethylurea, 98.0 +%

Sign In for Pricing
View Details
Tetraethylurea, 98.0 +%
242273-03 250 mL

Tetraethylurea, 98.0 +%

Sign In for Pricing
View Details
HHIPL2 Antibody
orb309376 100 µL

HHIPL2 Antibody

Sign In for Pricing
View Details
Lentiviral human PLCG2 sgRNA gene knockout kit - Lentiviral human PLCG2 sgRNA gene knockout kit (plasmid)
GTR15361868 1 Vial

Lentiviral human PLCG2 sgRNA gene knockout kit - Lentiviral human PLCG2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details