Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Transthyretin (ttr)

This Recombinant Xenopus laevis Transthyretin (ttr) spans the amino acid sequence from region 20-153aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transthyretin (xTTR) (Prealbumin)

UniProt

B7ZS96

Expression Region

20-153aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Xenopus laevis (African clawed frog)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APPGHASHGEADSKCPLMVKVLDAVRGIPAANLLVNVFRQTESGKWEQITSGKTTELGEIHNLTTDEQFTEGVYKIEFATKAFWGKLGLSPFHEYVDVVFTANDAGHRHYTIAVLLTPYSFSSTAIVSEPHDDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-C5AR2 antibody
STJ112602 100 µl

Anti-C5AR2 antibody

Sign In for Pricing
View Details
Phospho-PKC delta (Ser645) Antibody
E11-184456 100 µg -100 µL

Phospho-PKC delta (Ser645) Antibody

Sign In for Pricing
View Details
Tert-Butyl 5-aminohexahydrocyclopenta[c]pyrrole-2 (1H) -carboxylate
OR1045887-01 100 mg

Tert-Butyl 5-aminohexahydrocyclopenta[c]pyrrole-2 (1H) -carboxylate

Sign In for Pricing
View Details
Tert-Butyl 5-aminohexahydrocyclopenta[c]pyrrole-2 (1H) -carboxylate
OR1045887-02 250 mg

Tert-Butyl 5-aminohexahydrocyclopenta[c]pyrrole-2 (1H) -carboxylate

Sign In for Pricing
View Details
Tert-Butyl 5-aminohexahydrocyclopenta[c]pyrrole-2 (1H) -carboxylate
OR1045887-03 1 g

Tert-Butyl 5-aminohexahydrocyclopenta[c]pyrrole-2 (1H) -carboxylate

Sign In for Pricing
View Details
1,2-Epoxy-1H,1H,2H,3H,3H-heptadecafluoroundecane
275963-01 5 g

1,2-Epoxy-1H,1H,2H,3H,3H-heptadecafluoroundecane

Sign In for Pricing
View Details