Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacter agglomerans Ice nucleation protein (iceE), partial

This Recombinant Enterobacter agglomerans Ice nucleation protein (iceE), partial spans the amino acid sequence from region 1129-1258aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ice nucleation protein

UniProt

P16239

Expression Region

1129-1258aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans)

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAGERGKLIAGADSTQTAGDRSKLLAGNNSYLTAGDRSKLTAGNDCILMAGDRSKLTAGINSILTAGCRSKLIGSNGSTLTAGENSVLIFRCWDGKRYTNVVAKTGKGGIEADMPYQMDEDNNIVNKPEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mrpl44 (NM_001031650) Rat Tagged ORF Clone Lentiviral Particle
RR208387L4V 200 µL

Mrpl44 (NM_001031650) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
HIPP07 Antibody
orb790101 2 mg

HIPP07 Antibody

Sign In for Pricing
View Details
TSLP AAV Vector (Human) (CMV)
48572101 1 µg

TSLP AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Mouse Psmb1 Pre-designed siRNA Set A
SI111308A 1 Each

Mouse Psmb1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
TEAD2, ID (TEAD2, TEF4, Transcriptional enhancer factor TEF-4, TEA domain family member 2) (MaxLight 550)
MBS6354685-01 0.1 mL

TEAD2, ID (TEAD2, TEF4, Transcriptional enhancer factor TEF-4, TEA domain family member 2) (MaxLight 550)

Sign In for Pricing
View Details
TEAD2, ID (TEAD2, TEF4, Transcriptional enhancer factor TEF-4, TEA domain family member 2) (MaxLight 550)
MBS6354685-02 5x 0.1 mL

TEAD2, ID (TEAD2, TEF4, Transcriptional enhancer factor TEF-4, TEA domain family member 2) (MaxLight 550)

Sign In for Pricing
View Details