Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Angiogenin (Ang)

This Recombinant Mouse Angiogenin (Ang) spans the amino acid sequence from region 25-145aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Angiogenin (EC 3.1.27.-) (Angiogenin-1) (Ribonuclease 5) (RNase 5)

UniProt

P21570

Expression Region

25-145aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDDSRYTKFLTQHHDAKPKGRDDRYCERMMKRRSLTSPCKDVNTFIHGNKSNIKAICGANGSPYRENLRMSKSPFQVTTCKHTGGSPRPPCQYRASAGFRHVVIACENGLPVHFDESFFSL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti PDGFRL Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,ELISA) 200ul
IRBAMLPDGFRLAP477200UL 200 µL

Rabbit Anti PDGFRL Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,ELISA) 200ul

Sign In for Pricing
View Details
15mL Empty Spin Columns, outer tubes, inner tubes, UHMW-PE frits and fixing rings
007600 1 Package

15mL Empty Spin Columns, outer tubes, inner tubes, UHMW-PE frits and fixing rings

Sign In for Pricing
View Details
SFTPC antibody
70R-20216 50 ul

SFTPC antibody

Sign In for Pricing
View Details
Cts7 CRISPRa sgRNA lentivector (set of three targets)(Rat)
17091126 3x 1.0µg DNA

Cts7 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
BioGlobin SYS
SY-20265 5 L

BioGlobin SYS

Sign In for Pricing
View Details
Gdf15-set siRNA/shRNA/RNAi Lentivector (Mouse)
21416094 4x 500 ng

Gdf15-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details