Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Poly [ADP-ribose] polymerase 14 (PARP14), partial

This Recombinant Human Poly [ADP-ribose] polymerase 14 (PARP14), partial spans the amino acid sequence from region 1605-1801aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein mono-ADP-ribosyltransferase PARP14 (EC 2.4.2.-) (ADP-ribosyltransferase diphtheria toxin-like 8) (ARTD8) (B aggressive lymphoma protein 2) (Poly [ADP-ribose] polymerase 14) (PARP-14)

UniProt

Q460N5

Expression Region

1605-1801aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Molecular Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTCSHFRIEKIERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQLFHGTDAGSVPHVNRNGFNRSYAGKNAVAYGKGTYFAVNANYSANDTYSRPDANGRKHVYYVRVLTGIYTHGNHSLIVPPSKNPQNPTDLYDTVTDNVHHPSLFVAFYDYQAYPEYLITFRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP1S1 Polyclonal Antibody
E-AB-90205-01 60 µL

AP1S1 Polyclonal Antibody

Sign In for Pricing
View Details
AP1S1 Polyclonal Antibody
E-AB-90205-02 120 µL

AP1S1 Polyclonal Antibody

Sign In for Pricing
View Details
AP1S1 Polyclonal Antibody
E-AB-90205-03 200 µL

AP1S1 Polyclonal Antibody

Sign In for Pricing
View Details
1-Phenyl-5-(pyridin-2-yl)-2(1H)-pyridone
TRC-P336750-2.5G 2.5 g

1-Phenyl-5-(pyridin-2-yl)-2(1H)-pyridone

Sign In for Pricing
View Details
Vanillic Acid
TRC-V097350-100MG 100 mg

Vanillic Acid

Sign In for Pricing
View Details
FABP12 Polyclonal Antibody
E-AB-90431-01 60 µL

FABP12 Polyclonal Antibody

Sign In for Pricing
View Details