Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Quercus alba Major pollen allergen Que a 1, partial

This Recombinant Quercus alba Major pollen allergen Que a 1, partial spans the amino acid sequence from region 1-50aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Major pollen allergen Que a 1 (allergen Que a 1) (Fragment)

UniProt

P85126

Expression Region

1-50aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

Yeast

Origin

Quercus alba (White oak)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GVFTHESQETSVIAPARLFKALFLDSDNLIQKVLPQAIKSTEIIEGNGGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Platinum Gauze 3600 mesh/cm2, 0.04 mm wire diameter, 99.9%
GX9800-50x50mm 50x 50 mm

Platinum Gauze 3600 mesh/cm2, 0.04 mm wire diameter, 99.9%

Sign In for Pricing
View Details
25-Hydroxy Vitamin D3 3-Sulfate Sodium Salt (90%)
TRC-H995870-2.5MG 2.5 mg

25-Hydroxy Vitamin D3 3-Sulfate Sodium Salt (90%)

Sign In for Pricing
View Details
3-Bromotoluene
424725-01 500 mg

3-Bromotoluene

Sign In for Pricing
View Details
3-Bromotoluene
424725-02 1 g

3-Bromotoluene

Sign In for Pricing
View Details
Kti12 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3050004 1.0 µg DNA

Kti12 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Neurotrophin 3 (NTF3) (NM_001102654) Human Tagged ORF Clone Lentiviral Particle
RC214281L1V 200 µL

Neurotrophin 3 (NTF3) (NM_001102654) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details