Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytokine receptor common subunit gamma (IL2RG) (N75Q), partial

This Recombinant Human Cytokine receptor common subunit gamma (IL2RG) (N75Q), partial spans the amino acid sequence from region 56-254aa (N75Q) . Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytokine receptor common subunit gamma (Interleukin-2 receptor subunit gamma) (IL-2 receptor subunit gamma) (IL-2R subunit gamma) (IL-2RG) (gammaC) (p64) (CD antigen CD132)

UniProt

P31785

Expression Region

56-254aa (N75Q)

Tag

C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PLPEVQCFVFNVEYMNCTWQSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hepatocyte Growth Factor Receptor (MET) Antibody
abx328057-01 50 µg

Hepatocyte Growth Factor Receptor (MET) Antibody

Sign In for Pricing
View Details
Hepatocyte Growth Factor Receptor (MET) Antibody
abx328057-02 100 µg

Hepatocyte Growth Factor Receptor (MET) Antibody

Sign In for Pricing
View Details
Stat4, phosphorylated (Y693)
329314-01 50 µg

Stat4, phosphorylated (Y693)

Sign In for Pricing
View Details
Stat4, phosphorylated (Y693)
329314-02 100 µg

Stat4, phosphorylated (Y693)

Sign In for Pricing
View Details
Decr1 (NM_057197) Rat Untagged Clone
RN208399 10 µg

Decr1 (NM_057197) Rat Untagged Clone

Sign In for Pricing
View Details
DiagPoly™ Carboxyl Fluorescent Polystyrene Particles, Orange, 40 μm
DFCO-L015 1 mL

DiagPoly™ Carboxyl Fluorescent Polystyrene Particles, Orange, 40 μm

Sign In for Pricing
View Details