Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Epithelial cell adhesion molecule (Epcam), partial

This Recombinant Mouse Epithelial cell adhesion molecule (Epcam), partial spans the amino acid sequence from region 24-266aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Epithelial cell adhesion molecule (Ep-CAM) (Epithelial glycoprotein 314) (EGP314) (mEGP314) (Protein 289A) (Tumor-associated calcium signal transducer 1) (CD antigen CD326)

UniProt

Q99JW5

Expression Region

24-266aa

Tag

C-terminal Myc-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation; Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARP3 Rabbit Polyclonal Antibody (BF555)
orb1598455 100 µL

ARP3 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
ZIP12 Polyclonal Antibody
MBS8570685-01 0.1 mL

ZIP12 Polyclonal Antibody

Sign In for Pricing
View Details
ZIP12 Polyclonal Antibody
MBS8570685-02 0.1 mL (AF405L)

ZIP12 Polyclonal Antibody

Sign In for Pricing
View Details
ZIP12 Polyclonal Antibody
MBS8570685-03 0.1 mL (AF405S)

ZIP12 Polyclonal Antibody

Sign In for Pricing
View Details
ZIP12 Polyclonal Antibody
MBS8570685-04 0.1 mL (AF610)

ZIP12 Polyclonal Antibody

Sign In for Pricing
View Details
ZIP12 Polyclonal Antibody
MBS8570685-05 0.1 mL (AF635)

ZIP12 Polyclonal Antibody

Sign In for Pricing
View Details