Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human TLC domain-containing protein 1 (TLCD1)

This Recombinant Human TLC domain-containing protein 1 (TLCD1) spans the amino acid sequence from region 36-247aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TLC domain-containing protein 1 (Calfacilitin)

UniProt

Q96CP7

Expression Region

36-247aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RADPLRTWRWHNLLVSFAHSIVSGIWALLCVWQTPDMLVEIETAWSLSGYLLVCFSAGYFIHDTVDIVASGQTRASWEYLVHHVMAMGAFFSGIFWSSFVGGGVLTLLVEVSNIFLTIRMMMKISNAQDHLLYRVNKYVNLVMYFLFRLAPQAYLTHFFLRYVNQRTLGTFLLGILLMLDVMIIIYFSRLLRSDFCPEHVPKKQHKDKFLTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLN6 (NM_017882) Human Tagged ORF Clone Lentiviral Particle
RC201904L3V 200 µL

CLN6 (NM_017882) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit anti-human musashi homolog 2 (Drosophila) polyclonal Antibody
MBS716159-01 0.1 mL

Rabbit anti-human musashi homolog 2 (Drosophila) polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human musashi homolog 2 (Drosophila) polyclonal Antibody
MBS716159-02 5x 0.1 mL

Rabbit anti-human musashi homolog 2 (Drosophila) polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Filaggrin Antibody
NBP1-87527-25ul 25 µL

Rabbit Polyclonal Filaggrin Antibody

Sign In for Pricing
View Details
Recombinant Human HLA-DQA2 (His)
orb3067423 50 µg

Recombinant Human HLA-DQA2 (His)

Sign In for Pricing
View Details
IFITM3 Antibody
A25859-100UG 100 µg

IFITM3 Antibody

Sign In for Pricing
View Details