Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Potassium voltage-gated channel subfamily E member 2 (KCNE2)

This Recombinant Human Potassium voltage-gated channel subfamily E member 2 (KCNE2) spans the amino acid sequence from region 1-123aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Potassium voltage-gated channel subfamily E member 2 (MinK-related peptide 1) (Minimum potassium ion channel-related peptide 1) (Potassium channel subunit beta MiRP1)

UniProt

Q9Y6J6

Expression Region

1-123aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB6A Protein
OPPA02580-2UG 2 µg

RAB6A Protein

Sign In for Pricing
View Details
2- (2- (Tetrahydro-2H-pyran-4-yl) thiazol-4-yl) acetic acid
OR1102676-01 25 mg

2- (2- (Tetrahydro-2H-pyran-4-yl) thiazol-4-yl) acetic acid

Sign In for Pricing
View Details
2- (2- (Tetrahydro-2H-pyran-4-yl) thiazol-4-yl) acetic acid
OR1102676-02 50 mg

2- (2- (Tetrahydro-2H-pyran-4-yl) thiazol-4-yl) acetic acid

Sign In for Pricing
View Details
2- (2- (Tetrahydro-2H-pyran-4-yl) thiazol-4-yl) acetic acid
OR1102676-03 100 mg

2- (2- (Tetrahydro-2H-pyran-4-yl) thiazol-4-yl) acetic acid

Sign In for Pricing
View Details
2- (2- (Tetrahydro-2H-pyran-4-yl) thiazol-4-yl) acetic acid
OR1102676-04 250 mg

2- (2- (Tetrahydro-2H-pyran-4-yl) thiazol-4-yl) acetic acid

Sign In for Pricing
View Details
Recombinant Alteromonas macleodii Histidine--tRNA ligase (hisS1)
MBS1013632-01 0.02 mg (E-Coli)

Recombinant Alteromonas macleodii Histidine--tRNA ligase (hisS1)

Sign In for Pricing
View Details