Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cannabinoid receptor 2 (CNR2)

This Recombinant Human Cannabinoid receptor 2 (CNR2) spans the amino acid sequence from region 1-360aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cannabinoid receptor 2 (CB-2) (CB2) (hCB2) (CX5)

UniProt

P34972

Expression Region

1-360aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Talin1 Antibody (GT24212)
NBP3-13607 100 µL

Mouse Monoclonal Talin1 Antibody (GT24212)

Sign In for Pricing
View Details
Olfr1466 CRISPR Activation Plasmid (m)
sc-434810-ACT 20 µg

Olfr1466 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
NPAP1 Polyclonal Antibody, PE-Cy7 Conjugated
bs-9625R-PE-Cy7-01 20 µL

NPAP1 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
NPAP1 Polyclonal Antibody, PE-Cy7 Conjugated
bs-9625R-PE-Cy7-02 100 µL

NPAP1 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O139:H28 (strain E24377A/ETEC) PYRH Polyclonal Antibody
MBS7169684 Inquire

Rabbit anti-Escherichia coli O139:H28 (strain E24377A/ETEC) PYRH Polyclonal Antibody

Sign In for Pricing
View Details
mmu-miR-145a-5p miRNA Mimic
MBS8300671-01 5 nmol

mmu-miR-145a-5p miRNA Mimic

Sign In for Pricing
View Details