What sizes are available for Recombinant Human T-cell antigen CD7 (CD7), partial (Active)?

Recombinant Human T-cell antigen CD7 (CD7), partial (Active) is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Human T-cell antigen CD7 (CD7), partial (Active) come in?

Recombinant Human T-cell antigen CD7 (CD7), partial (Active) is available in 3 different pack sizes.

Recombinant Human T-cell antigen CD7 (CD7), partial (Active)

Q: What is the catalog number for Recombinant Human T-cell antigen CD7 (CD7), partial (Active)?

The catalog number for Recombinant Human T-cell antigen CD7 (CD7), partial (Active) is orb1095903.

This Recombinant Human T-cell antigen CD7 (CD7), partial (Active) spans the amino acid sequence from region 26-180aa. Purity: Greater than 94.5% as determined by SDS-PAGE.

Product Specifications

UniProt

P09564

Expression Region

26-180aa

Tag

C-terminal hFc1-Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 94.5% as determined by SDS-PAGE.

Bioactivity

1Measured by its binding ability in a functional ELISA. Immobilized CD7 at 5 μg/ml can bind SECTM1, the EC50 is 1.236-1.773 ng/ml.2Human CD7 protein hFc and Myc tag captured on COOH chip can bind Human SECTM1 protein hFc tag with an affinity constant of 1.84 nM as detected by LSPR Assay.

Form

Lyophilized powder

Molecular Weight

46.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP