Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD226 antigen (CD226), partial (Active)

This Recombinant Human CD226 antigen (CD226), partial (Active) spans the amino acid sequence from region 19-247aa. Purity: Greater than 93% as determined by SDS-PAGE.

Product Specifications

UniProt

Q15762

Expression Region

19-247aa

Tag

C-terminal hFc1-Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 93% as determined by SDS-PAGE.

Bioactivity

FACS assay shows that Human CD226 can bind to 293F cell overexpressing human CD155.

Form

Lyophilized powder

Molecular Weight

56.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCEAL5 Protein Vector (Mouse) (pPB-N-His)
PV236987 500 ng

TCEAL5 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Rat Squalene monooxygenase (Sqle)
MBS7030348-01 0.02 mg

Recombinant Rat Squalene monooxygenase (Sqle)

Sign In for Pricing
View Details
Recombinant Rat Squalene monooxygenase (Sqle)
MBS7030348-02 0.1 mg

Recombinant Rat Squalene monooxygenase (Sqle)

Sign In for Pricing
View Details
Recombinant Rat Squalene monooxygenase (Sqle)
MBS7030348-03 5x 0.1 mg

Recombinant Rat Squalene monooxygenase (Sqle)

Sign In for Pricing
View Details
C8orf45 Rabbit Polyclonal Antibody (Cy7)
orb1060991 100 µL

C8orf45 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Mouse Hexa qPCR Primer Pair
QM14630S 200 Tests

Mouse Hexa qPCR Primer Pair

Sign In for Pricing
View Details