Recombinant Human Tumor necrosis factor receptor superfamily member 11B (TNFRSF11B) (Active)
This Recombinant Human Tumor necrosis factor receptor superfamily member 11B (TNFRSF11B) (Active) spans the amino acid sequence from region 22-401aa. Purity: Greater than 93.6% as determined by SDS-PAGE.
Product Specifications
UniProt
O00300
Expression Region
22-401aa
Tag
C-terminal hFc1-Flag-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Cancer Biology; Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 93.6% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized TNFSF11 at 10 μg/ml can bind human TNFRSF11B, the EC50 is 2.651-7.646 ng/ml.
Form
Lyophilized powder
Molecular Weight
73.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
AA Sequence
ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040050-500 1x 500 µL
IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042216-100 1x 100 µL
CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882652-500 1x 500 µL
B7-H4 (Immuno-Inhibitory Protein) (B7H4/2652R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details