What is the catalog number for Recombinant Human Mucin-16 (MUC16), partial (Active)?

The catalog number for Recombinant Human Mucin-16 (MUC16), partial (Active) is orb1095897.

What sizes are available for Recombinant Human Mucin-16 (MUC16), partial (Active)?

Recombinant Human Mucin-16 (MUC16), partial (Active) is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Human Mucin-16 (MUC16), partial (Active) come in?

Recombinant Human Mucin-16 (MUC16), partial (Active) is available in 3 different pack sizes.

Is Recombinant Human Mucin-16 (MUC16), partial (Active) in stock?

Recombinant Human Mucin-16 (MUC16), partial (Active) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Human Mucin-16 (MUC16), partial (Active)

This Recombinant Human Mucin-16 (MUC16), partial (Active) spans the amino acid sequence from region 12660-12923aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

Q8WXI7

Expression Region

12660-12923aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized MUC16 at 10 μg/ml can bind MSLN, the EC50 is 460.7-662.2 ng/ml.

Form

Lyophilized powder

Molecular Weight

30.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGM