Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mucin-16 (MUC16), partial (Active)

This Recombinant Human Mucin-16 (MUC16), partial (Active) spans the amino acid sequence from region 12660-12923aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

Q8WXI7

Expression Region

12660-12923aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized MUC16 at 10 μg/ml can bind MSLN, the EC50 is 460.7-662.2 ng/ml.

Form

Lyophilized powder

Molecular Weight

30.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal p70 S6 Kinase/S6K Antibody [PerCP]
NB100-293PCP 0.1 mL

Rabbit Polyclonal p70 S6 Kinase/S6K Antibody [PerCP]

Sign In for Pricing
View Details
SNRPA Antibody (Center)
MBS9232114-01 0.1 mL

SNRPA Antibody (Center)

Sign In for Pricing
View Details
SNRPA Antibody (Center)
MBS9232114-02 5x 0.1 mL

SNRPA Antibody (Center)

Sign In for Pricing
View Details
RPUSD1 Adenovirus (Human)
42725051 1.0 mL

RPUSD1 Adenovirus (Human)

Sign In for Pricing
View Details
Rabbit Anti-MT-ATP6 antibody
SL17865R-01 50 µL

Rabbit Anti-MT-ATP6 antibody

Sign In for Pricing
View Details
Rabbit Anti-MT-ATP6 antibody
SL17865R-02 100 µL

Rabbit Anti-MT-ATP6 antibody

Sign In for Pricing
View Details