Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Growth hormone receptor (GHR), partial, Biotinylated (Active)

This Recombinant Human Growth hormone receptor (GHR), partial, Biotinylated (Active) spans the amino acid sequence from region 27-264aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P10912

Expression Region

27-264aa

Tag

C-terminal mFc-Avi-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized human GH1 at 2 μg/ml can bind Biotinylated human GHR, the EC50 is 2.067-3.208 ng/ml.

Form

Lyophilized powder

Molecular Weight

56.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nucleic Acid Purification System BNPS-101
BNPS-101 1 Unit

Nucleic Acid Purification System BNPS-101

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1952), Biotin conjugate, 0.1mg/mL
BNCB1952-500 1x 500 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1952), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Mediastinum
CS511836 5x 5 µm

Frozen Tissue Sections, Mediastinum

Sign In for Pricing
View Details
Frozen Tissue Sections, Fallopian tube
CS501756 5x 5 µm

Frozen Tissue Sections, Fallopian tube

Sign In for Pricing
View Details
Recombinant beta-2 Adrenergic Receptor Monoclonal Antibody
AN301445L-01 50 µL

Recombinant beta-2 Adrenergic Receptor Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant beta-2 Adrenergic Receptor Monoclonal Antibody
AN301445L-02 100 µL

Recombinant beta-2 Adrenergic Receptor Monoclonal Antibody

Sign In for Pricing
View Details