Recombinant Human Tumor necrosis factor ligand superfamily member 8 (TNFSF8), partial (Active)
This Recombinant Human Tumor necrosis factor ligand superfamily member 8 (TNFSF8), partial (Active) spans the amino acid sequence from region 63-234aa. Purity: Greater than 94% as determined by SDS-PAGE.
Product Specifications
UniProt
P32971
Expression Region
63-234aa
Tag
N-terminal hFc-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Cancer Biology; Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 94% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized CD30 at 5 μg/ml can bind human CD30L, the EC50 is 4.169-6.360 ng/ml.
Form
Lyophilized powder
Molecular Weight
45.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
AA Sequence
QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC472848-500 1x 500 µL
Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940266-100 1x 100 µL
Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680253-500 1x 500 µL
Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040791-100 1x 100 µL
Smooth Muscle Actin (ACTA2/791), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details