Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leukemia inhibitory factor (LIF) (Active)

This Recombinant Human Leukemia inhibitory factor (LIF) (Active) spans the amino acid sequence from region 23-202aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P15018

Expression Region

23-202aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized human LIF at 2 μg/ml can bind human LIFR, the EC50 is 22.58-30.24 ng/ml.

Form

Lyophilized powder

Molecular Weight

48.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human EYA2 Knockout HEK293T cell line
GTR15403105 1 Vial

Human EYA2 Knockout HEK293T cell line

Sign In for Pricing
View Details
Human ATP7B qPCR Primer Pair
QH10873S 200 Tests

Human ATP7B qPCR Primer Pair

Sign In for Pricing
View Details
Ctsr Protein Vector (Rat) (pPM-C-HA)
PV262360 500 ng

Ctsr Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
PRPH Antibody
MBS9406071-01 0.1 mL

PRPH Antibody

Sign In for Pricing
View Details
PRPH Antibody
MBS9406071-02 5x 0.1 mL

PRPH Antibody

Sign In for Pricing
View Details
Recombinant Contactin Associated Protein 1 (Caspr)
TRV-0012817-01 10 µg

Recombinant Contactin Associated Protein 1 (Caspr)

Sign In for Pricing
View Details