Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leukemia inhibitory factor (LIF) (Active)

This Recombinant Human Leukemia inhibitory factor (LIF) (Active) spans the amino acid sequence from region 23-202aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P15018

Expression Region

23-202aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized human LIF at 2 μg/ml can bind human LIFR, the EC50 is 22.58-30.24 ng/ml.

Form

Lyophilized powder

Molecular Weight

48.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat GH (Growth Hormone) ELISA Kit
orb2648193-01 48 Tests

Goat GH (Growth Hormone) ELISA Kit

Sign In for Pricing
View Details
Goat GH (Growth Hormone) ELISA Kit
orb2648193-02 96 Tests

Goat GH (Growth Hormone) ELISA Kit

Sign In for Pricing
View Details
K5 Antibody
orb2677136-01 50 µL

K5 Antibody

Sign In for Pricing
View Details
K5 Antibody
orb2677136-02 100 µL

K5 Antibody

Sign In for Pricing
View Details
K5 Antibody
orb2677136-03 200 µL

K5 Antibody

Sign In for Pricing
View Details
Shigella tropina Rabbit pAb, AP conjugated
orb2887297 100 µL

Shigella tropina Rabbit pAb, AP conjugated

Sign In for Pricing
View Details