Recombinant Human papillomavirus type 16 Protein E7 (E7) (Active)
This Recombinant Human papillomavirus type 16 Protein E7 (E7) (Active) spans the amino acid sequence from region 1-98aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Protein E7
UniProt
P03129
Expression Region
1-98aa
Tag
N-terminal 6xHis-tagged and C-terminal 6xHis-tagged
Source
E.coli
Origin
Human papillomavirus type 16
Field of Research
Microbiology
Purity
Greater than 90% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized HPV16 E7 at 10 μg/mL can bind Biotinylated MYC, the EC50 is 268.1-354.3 ng/mL.
Form
Lyophilized powder
Molecular Weight
16.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
AA Sequence
MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15331710 1 Vial
Lentiviral human FAM122C shRNA (UAS) - Lentiviral human FAM122C shRNA (UAS, iRFP) (100)
Sign In for Pricing
View Details MBS1397535-01 0.02 mg (E-Coli)
Recombinant Arabidopsis thaliana Transcription factor MUTE (MUTE)
Sign In for Pricing
View Details MBS1397535-02 0.1 mg (E-Coli)
Recombinant Arabidopsis thaliana Transcription factor MUTE (MUTE)
Sign In for Pricing
View Details MBS1397535-03 0.02 mg (Yeast)
Recombinant Arabidopsis thaliana Transcription factor MUTE (MUTE)
Sign In for Pricing
View Details