Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus type 16 Protein E7 (E7) (Active)

This Recombinant Human papillomavirus type 16 Protein E7 (E7) (Active) spans the amino acid sequence from region 1-98aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein E7

UniProt

P03129

Expression Region

1-98aa

Tag

N-terminal 6xHis-tagged and C-terminal 6xHis-tagged

Source

E.coli

Origin

Human papillomavirus type 16

Field of Research

Microbiology

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized HPV16 E7 at 10 μg/mL can bind Biotinylated MYC, the EC50 is 268.1-354.3 ng/mL.

Form

Lyophilized powder

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human FAM122C shRNA (UAS) - Lentiviral human FAM122C shRNA (UAS, iRFP) (100)
GTR15331710 1 Vial

Lentiviral human FAM122C shRNA (UAS) - Lentiviral human FAM122C shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
ALK (Biotin)
554934-01 50 µg

ALK (Biotin)

Sign In for Pricing
View Details
ALK (Biotin)
554934-02 100 µg

ALK (Biotin)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Transcription factor MUTE (MUTE)
MBS1397535-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Transcription factor MUTE (MUTE)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Transcription factor MUTE (MUTE)
MBS1397535-02 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Transcription factor MUTE (MUTE)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Transcription factor MUTE (MUTE)
MBS1397535-03 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Transcription factor MUTE (MUTE)

Sign In for Pricing
View Details