Recombinant Human HLA class II histocompatibility antigen gamma chain (CD74), partial (Active)
This Recombinant Human HLA class II histocompatibility antigen gamma chain (CD74), partial (Active) spans the amino acid sequence from region 73-232aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
(HLA-DR antigens-associated invariant chain) (Ia antigen-associated invariant chain) (Ii) (CD antigen CD74)
UniProt
P04233
Expression Region
73-232aa
Tag
N-terminal 10xHis-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation; Cell Biology
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human CD74 at 2 μg/mL can bind Anti-CD74 recombinant antibody, the EC50 is 1.317-1.646 ng/mL.
Form
Lyophilized powder
Molecular Weight
21.0 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
AA Sequence
QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB2151-100 1x 100 µL
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2151), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![HMGB1 Recombinant Rabbit monoclonal Antibody [SA39-03]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea829c8/imageurl/et1601-2-50ul.webp)
ET1601-2-50UL 50 µL
HMGB1 Recombinant Rabbit monoclonal Antibody [SA39-03]
Sign In for Pricing
View Details 
BNUM0426-50 1x 50 µL
Calprotectin (MRP14) (S100A9) (CAGB/426), 1mg/mL
Sign In for Pricing
View Details