Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Prolactin receptor (Prlr), partial (Active)

This Recombinant Mouse Prolactin receptor (Prlr), partial (Active) spans the amino acid sequence from region 20-229aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(PRL-R)

UniProt

Q08501

Expression Region

20-229aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Mouse Prlr at 5 μg/mL can bind Anti-PRLR recombinant antibody, the EC50 is 4.021-8.706 ng/mL.

Form

Lyophilized powder

Molecular Weight

27.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

AA Sequence

QSPPGKPEIHKCRSPDKETFTCWWNPGSDGGLPTNYSLTYSKEGEKNTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNEMGSSTSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWLPPTITDVKTGWFTMEYEIRLKSEEADEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWGQEKSIEIPNDFTLKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Reinforced HiVeg™ Medium for Clostridia
LQV130C-5X100ML 1 unit

Reinforced HiVeg™ Medium for Clostridia

Sign In for Pricing
View Details
Slco1a5 Mouse qPCR Template Standard (NM_130861)
MK204758 1 Kit

Slco1a5 Mouse qPCR Template Standard (NM_130861)

Sign In for Pricing
View Details
CD6 3'UTR GFP Stable Cell Line
TU053870 1.0 mL

CD6 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Porcine Vascular Endothelial Growth Factor B (VEGF-B) ELISA Kit
MBS269684-01 48 Well

Porcine Vascular Endothelial Growth Factor B (VEGF-B) ELISA Kit

Sign In for Pricing
View Details
Porcine Vascular Endothelial Growth Factor B (VEGF-B) ELISA Kit
MBS269684-02 96 Well

Porcine Vascular Endothelial Growth Factor B (VEGF-B) ELISA Kit

Sign In for Pricing
View Details
Porcine Vascular Endothelial Growth Factor B (VEGF-B) ELISA Kit
MBS269684-03 5x 96 Well

Porcine Vascular Endothelial Growth Factor B (VEGF-B) ELISA Kit

Sign In for Pricing
View Details