Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB5C, Human (HEK293, His)

The IL5 protein is a cytokine that plays a key role in regulating immune responses, particularly in promoting the production and activation of eosinophils. It is involved in regulating allergic and inflammatory processes. RAB5C Protein, Human (HEK293, His) is the recombinant human-derived RAB5C, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

RAB5C Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rab5c-human-hek293-his.html

Purity

98.0

Smiles

MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN

Molecular Formula

5878 (Gene_ID) NP_958842 (M1-N216) (Accession)

Molecular Weight

Approximately 25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Salmonella newport Bifunctional protein aas (aas)
MBS7007078-01 0.02 mg

Recombinant Salmonella newport Bifunctional protein aas (aas)

Ask
View Details
Recombinant Salmonella newport Bifunctional protein aas (aas)
MBS7007078-02 0.1 mg

Recombinant Salmonella newport Bifunctional protein aas (aas)

Ask
View Details
Recombinant Salmonella newport Bifunctional protein aas (aas)
MBS7007078-03 5x 0.1 mg

Recombinant Salmonella newport Bifunctional protein aas (aas)

Ask
View Details
TCEA3 (TFIISH, Transcription Elongation Factor A Protein 3, Transcription Elongation Factor S-II Protein 3, Transcription Elongation Factor TFIIS.h) (PE)
MBS6396169-01 0.1 mL

TCEA3 (TFIISH, Transcription Elongation Factor A Protein 3, Transcription Elongation Factor S-II Protein 3, Transcription Elongation Factor TFIIS.h) (PE)

Ask
View Details
TCEA3 (TFIISH, Transcription Elongation Factor A Protein 3, Transcription Elongation Factor S-II Protein 3, Transcription Elongation Factor TFIIS.h) (PE)
MBS6396169-02 5x 0.1 mL

TCEA3 (TFIISH, Transcription Elongation Factor A Protein 3, Transcription Elongation Factor S-II Protein 3, Transcription Elongation Factor TFIIS.h) (PE)

Ask
View Details
HGFA Polyclonal Antibody, Cy3 Conjugated
bs-9913R-Cy3 100 µL

HGFA Polyclonal Antibody, Cy3 Conjugated

Ask
View Details