Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB5C, Human (HEK293, His)

The IL5 protein is a cytokine that plays a key role in regulating immune responses, particularly in promoting the production and activation of eosinophils. It is involved in regulating allergic and inflammatory processes. RAB5C Protein, Human (HEK293, His) is the recombinant human-derived RAB5C, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

RAB5C Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rab5c-human-hek293-his.html

Purity

98.0

Smiles

MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN

Molecular Formula

5878 (Gene_ID) NP_958842 (M1-N216) (Accession)

Molecular Weight

Approximately 25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

pET-43.1b Plasmid
PVT0361 2 µg

pET-43.1b Plasmid

Sign In for Pricing
View Details
Anti-IGF2BP3 Antibody
CQA2023-01 30 µL

Anti-IGF2BP3 Antibody

Sign In for Pricing
View Details
Anti-IGF2BP3 Antibody
CQA2023-02 50 μL

Anti-IGF2BP3 Antibody

Sign In for Pricing
View Details
Anti-IGF2BP3 Antibody
CQA2023-03 100 µL

Anti-IGF2BP3 Antibody

Sign In for Pricing
View Details
Anti-IGF2BP3 Antibody
CQA2023-04 200 µL

Anti-IGF2BP3 Antibody

Sign In for Pricing
View Details
CYB5D1 (NM_144607) Human Over-expression Lysate
LH14145V 100 µg

CYB5D1 (NM_144607) Human Over-expression Lysate

Sign In for Pricing
View Details