Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human E3 ubiquitin-protein ligase ZNRF3 (ZNRF3), partial (Active)

This Recombinant Human E3 ubiquitin-protein ligase ZNRF3 (ZNRF3), partial (Active) spans the amino acid sequence from region 56-219aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(RING finger protein 203) (RING-type E3 ubiquitin transferase ZNRF3) (Zinc/RING finger protein 3)

UniProt

Q9ULT6

Expression Region

56-219aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology; Molecular Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human ZNRF3 at 5 μg/mL can bind Human RSPO2, the EC50 is 5.091-6.991 ng/mL.

Form

Lyophilized powder

Molecular Weight

20.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC27 Mouse Monoclonal Antibody
AMM80858-01 1 Each

CDC27 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CDC27 Mouse Monoclonal Antibody
AMM80858-02 50 µL

CDC27 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CDC27 Mouse Monoclonal Antibody
AMM80858-03 100 µL

CDC27 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Phospho-Tau-T548 Rabbit pAb
AP0957 20 µL

Phospho-Tau-T548 Rabbit pAb

Sign In for Pricing
View Details
C16orf58 3'UTR Luciferase Stable Cell Line
TU003000 1.0 mL

C16orf58 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ZBTB6 Protein Vector (Mouse) (pPB-N-His)
PV248379 500 ng

ZBTB6 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details