Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Alginate lyase (algL)

This Recombinant Alginate lyase (algL) spans the amino acid sequence from region 24-374aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Poly (beta-D-mannuronate) lyase

UniProt

O52195

Expression Region

24-374aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Azotobacter vinelandii

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

59 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEALVPPKGYYAPVDIRKGEAPACPVVPEPFTGELVFRSKYEGSDAARSTLNEEAEKAFRTKTAPITQIERGVSRMVMRYMEKGRAGDLECTLAWLDAWAEDGALLTTEYNHTGKSMRKWALGSLAGAYLRLKFSSSQPLAAYPEQARRIESWFAKVGDQVIKDWSDLPLKRINNHSYWAAWAVMAAGVATNRRPLFDWAVEQFHIAAGQVDSNGFLPNELKRRQRALAYHNYSLPPLMMVAAFALANGVDLRGDNDGALGRLAGNVLAGVEKPEPFAERAGDEDQDMEDLETDAKFSWLEPYCALYSCSPALRERKAEMGPFKNFRLGGDVTRIFDPAEKSPRSTVGKRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Normal Skin Lysate (0 days old)
450109 0.1 mg

Mouse Normal Skin Lysate (0 days old)

Sign In for Pricing
View Details
BIK Conjugated Antibody
orb1619886 100 µL

BIK Conjugated Antibody

Sign In for Pricing
View Details
ZKSC2 rabbit pAb
ES12199-01 50 µL

ZKSC2 rabbit pAb

Sign In for Pricing
View Details
ZKSC2 rabbit pAb
ES12199-02 100 µL

ZKSC2 rabbit pAb

Sign In for Pricing
View Details
Rufy4 Mouse Gene Knockout Kit (CRISPR)
KN515204 1 Kit

Rufy4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
XFD647 Anti-human CD140a Antibody *16A1*
11400171-AAT 500 Tests

XFD647 Anti-human CD140a Antibody *16A1*

Sign In for Pricing
View Details