Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Histidine triad nucleotide-binding protein 1 (HINT1)

This Recombinant Rabbit Histidine triad nucleotide-binding protein 1 (HINT1) spans the amino acid sequence from region 2-126aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adenosine 5'-monophosphoramidase P13.7

UniProt

P80912

Expression Region

2-126aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDQCLAFHDISPQAPTHFLVIPKKHISQISAAEDADESLLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Timm17b ORF Vector (Rat) (pORF)
ORF077716 1.0 µg DNA

Timm17b ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Ferritin (FT) Deficient Human Plasma Lyophilized
MBS136425-01 1 mL

Ferritin (FT) Deficient Human Plasma Lyophilized

Sign In for Pricing
View Details
Ferritin (FT) Deficient Human Plasma Lyophilized
MBS136425-02 10 mL

Ferritin (FT) Deficient Human Plasma Lyophilized

Sign In for Pricing
View Details
Ferritin (FT) Deficient Human Plasma Lyophilized
MBS136425-03 5x 10 mL

Ferritin (FT) Deficient Human Plasma Lyophilized

Sign In for Pricing
View Details
Alkyne CPG modifier 500, 500 mg
32860 500 mg

Alkyne CPG modifier 500, 500 mg

Sign In for Pricing
View Details
Sodium taurocholate hydrate
GL2114-25g 25 g

Sodium taurocholate hydrate

Sign In for Pricing
View Details