Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Histidine triad nucleotide-binding protein 1 (HINT1)

This Recombinant Rabbit Histidine triad nucleotide-binding protein 1 (HINT1) spans the amino acid sequence from region 2-126aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adenosine 5'-monophosphoramidase P13.7

UniProt

P80912

Expression Region

2-126aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDQCLAFHDISPQAPTHFLVIPKKHISQISAAEDADESLLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP-1 Substrate
HY-P10043 1 Each

MMP-1 Substrate

Sign In for Pricing
View Details
Anti-SDHB Antibody Picoband® Fluoro550 Conjugated
A01090-Fluoro550 100 µg/Vial

Anti-SDHB Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
SCAMP4 (E8Y6Z) Rabbit Monoclonal Antibody
CST 99948T 20 µL

SCAMP4 (E8Y6Z) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Lentiviral human ACE sgRNA gene knockout kit - Lentiviral human ACE sgRNA gene knockout kit (25)
GTR15389208 1 Vial

Lentiviral human ACE sgRNA gene knockout kit - Lentiviral human ACE sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
CD1D Protein (C-human IgG1-Fc & His, Mouse)
P522736 100 µg

CD1D Protein (C-human IgG1-Fc & His, Mouse)

Sign In for Pricing
View Details
OPRM1 Antibody : Biotin (OAAF00643-Biotin)
OAAF00643-100UG-Biotin 100 µg

OPRM1 Antibody : Biotin (OAAF00643-Biotin)

Sign In for Pricing
View Details