Recombinant Rabbit Histidine triad nucleotide-binding protein 1 (HINT1)
This Recombinant Rabbit Histidine triad nucleotide-binding protein 1 (HINT1) spans the amino acid sequence from region 2-126aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Adenosine 5'-monophosphoramidase P13.7
UniProt
P80912
Expression Region
2-126aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
Mammalian cell
Origin
Oryctolagus cuniculus (Rabbit)
Field of Research
Pharmacology & Drug Discovery
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
17.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDQCLAFHDISPQAPTHFLVIPKKHISQISAAEDADESLLGHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10349235 96 Well
Guinea Pig Caseinolytic peptidase B protein homolog (CLPB) ELISA Kit
Sign In for Pricing
View Details 
MBS2101579-01 5x 96 Tests
Human Calcium Activated Nucleotidase 1 (CANT1) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details MBS2101579-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)
Human Calcium Activated Nucleotidase 1 (CANT1) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details MBS2101579-03 10x 96 Tests
Human Calcium Activated Nucleotidase 1 (CANT1) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details