Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGF beta 1/TGFB1, Human (HEK293)

TGF beta 1/TGFB1 Protein is initially identified as a growth factor that induces the growth of rodent fibroblasts. TGF beta 1/TGFB1 Protein inhibits the cell cycle in the G1 phase. TGF beta 1/TGFB1 is an endogenous factor controlling apoptosis in normal and pathological tissues. TGF beta 1/TGFB1 Protein, Human (HEK293) is a recombinant protein (A279-S390) produced by HEK293 cells[1][2].

Product Specifications

Product Name Alternative

TGF beta 1/TGFB1 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tgf-beta-1-protein-human-112a-a-hek293.html

Purity

98.0

Smiles

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Molecular Formula

7040 (Gene_ID) P01137 (A279-S390) (Accession)

Molecular Weight

Approximately 13-15 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]K. Miyazono, et al. A role of the latent TGF-beta 1-binding protein in the assembly and secretion of TGF-beta 1. The EMBO Journal (1991) 10:1091-1101.|[2]M Selvakumaran, et al. The novel primary response gene MyD118 and the proto-oncogenes myb, myc, and bcl-2 modulate transforming growth factor beta 1-induced apoptosis of myeloid leukemia cells. Mol Cell Biol. 1994 Apr;14 (4) :2352-60.|[3]Chambaz E.M., et al. Transforming Growth Factor-βs: A Multifunctional Cytokine Family. Implication in the Regulation of Adrenocortical Cell Endocrine Functions. 1991. |[4]Dulce Maroni, et al. TGFB1 disrupts the angiogenic potential of microvascular endothelial cells of the corpus luteum. Cell Sci. 2011 Jul 15;124 (Pt 14) :2501-10.|[5]Nan Wu, et al. LINC00941 promotes CRC metastasis through preventing SMAD4 protein degradation and activating the TGF-β/SMAD2/3 signaling pathway. Cell Death Differ. 2021 Jan;28 (1) :219-232. |[6]Hai Zhang, et al. Effects of transforming growth factor-beta 1 (TGF-beta1) on in vitro mineralization of human osteoblasts on implant materials. Biomaterials. 2003 May;24 (12) :2013-20. |[7]Paloma B Liton, et al. Cross-talk between TGF-beta1 and IL-6 in human trabecular meshwork cells. Mol Vis. 2009;15:326-34. Epub 2009 Feb 11.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Compound T127596
orb3170383-01 1 mg

Compound T127596

Sign In for Pricing
View Details
Compound T127596
orb3170383-02 2 mg

Compound T127596

Sign In for Pricing
View Details
Compound T127596
orb3170383-03 3 mg

Compound T127596

Sign In for Pricing
View Details
Compound T127596
orb3170383-04 4 mg

Compound T127596

Sign In for Pricing
View Details
Compound T127596
orb3170383-05 5 mg

Compound T127596

Sign In for Pricing
View Details
Semaphorin 5A (Semaphorin-F, Sema F, Semaphorin-5A, SEMAF, SEMA5A) (MaxLight 650) discontinued
S0668-57B-ML650 100 µL

Semaphorin 5A (Semaphorin-F, Sema F, Semaphorin-5A, SEMAF, SEMA5A) (MaxLight 650) discontinued

Sign In for Pricing
View Details