Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-1 beta protein (IL1B) (Active)

Product Specifications

Product Name Alternative

IL-1 beta

Abbreviation

Recombinant Human IL1B protein (Active)

Gene Name

IL1B

UniProt

P01584

Expression Region

117-269aa

Organism

Homo sapiens (Human)

Target Sequence

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. {ECO:0000269|PubMed:3920526}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>97% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 1.0 pg/ml, corresponding to a specific activity of > 1.0 x 109 IU/mg.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells.

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lxn Mouse shRNA Plasmid (Locus ID 17035)
TR516123 1 Kit

Lxn Mouse shRNA Plasmid (Locus ID 17035)

Sign In for Pricing
View Details
Total Chlorine Reagent 0-2.50mg L
HI9370103 300 / PCK

Total Chlorine Reagent 0-2.50mg L

Sign In for Pricing
View Details
Chicken Complement fragment 5a ELISA Kit
MBS750880-01 48 Well

Chicken Complement fragment 5a ELISA Kit

Sign In for Pricing
View Details
Chicken Complement fragment 5a ELISA Kit
MBS750880-02 96 Well

Chicken Complement fragment 5a ELISA Kit

Sign In for Pricing
View Details
Chicken Complement fragment 5a ELISA Kit
MBS750880-03 5x 96 Well

Chicken Complement fragment 5a ELISA Kit

Sign In for Pricing
View Details
Chicken Complement fragment 5a ELISA Kit
MBS750880-04 10x 96 Well

Chicken Complement fragment 5a ELISA Kit

Sign In for Pricing
View Details