Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Basigin/CD147, Cynomolgus (HEK293, His)

Basigin, also called CD147 or EMMPRIN, is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily with homology to both the immunoglobulin V domain and major histocompatibility complex class II antigen -chain. Basigin is the receptor for cyclophilins, S100A9 and platelet glycoprotein VI. Basigin tightly associates with monocarboxylate transporters and is essential for their cell surface translocation and activities [1][2][3]. Basigin/CD147 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Basigin/CD147 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Basigin/CD147 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/basigin-cd147-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

AYGAAGTVSTSVENIGSKTLLTCSLNDSSTEVTGHRWLKGGAVLKEDTLPGQKTDFEVDSDDLGGEYSCVFLPEPTGRADIQLDALLSGAPRVKAVKSSEHVSEGETAVLACKSESLPPVTTWVWYKITDSGDQVIVNGSQGRFFVSSSQGRSELRIENLNMEADPGKYACNGTSSEGTDQATVTLRVRSH

Molecular Formula

102121721 (Gene_ID) XP_005587354 (A19-H209) (Accession)

Molecular Weight

Approximately 27-33 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE anti-human CD21
E16FHP021-025 25 Tests

PE anti-human CD21

Sign In for Pricing
View Details
STAT6 Protein Lysate (Mouse) with C-HA Tag
45701034 100 µg

STAT6 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
RGD1559613 Protein Vector (Rat) (pPM-C-His)
PV300169 500 ng

RGD1559613 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
RBM38 Protein Vector (Mouse) (pPB-C-His)
PV222906 500 ng

RBM38 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
FAM187A Protein Vector (Human) (pPM-C-HA)
PV076867 500 ng

FAM187A Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Human SOCS2 (Suppressors Of Cytokine Signaling 2) ELISA Kit
EH24653 96 Tests

Human SOCS2 (Suppressors Of Cytokine Signaling 2) ELISA Kit

Sign In for Pricing
View Details