Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Basigin/CD147, Cynomolgus (HEK293, His)

Basigin, also called CD147 or EMMPRIN, is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily with homology to both the immunoglobulin V domain and major histocompatibility complex class II antigen -chain. Basigin is the receptor for cyclophilins, S100A9 and platelet glycoprotein VI. Basigin tightly associates with monocarboxylate transporters and is essential for their cell surface translocation and activities [1][2][3]. Basigin/CD147 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Basigin/CD147 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Basigin/CD147 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/basigin-cd147-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

AYGAAGTVSTSVENIGSKTLLTCSLNDSSTEVTGHRWLKGGAVLKEDTLPGQKTDFEVDSDDLGGEYSCVFLPEPTGRADIQLDALLSGAPRVKAVKSSEHVSEGETAVLACKSESLPPVTTWVWYKITDSGDQVIVNGSQGRFFVSSSQGRSELRIENLNMEADPGKYACNGTSSEGTDQATVTLRVRSH

Molecular Formula

102121721 (Gene_ID) XP_005587354 (A19-H209) (Accession)

Molecular Weight

Approximately 27-33 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Brucella Suis ahpD Protein (aa 1-175)
VAng-Lsx5629-1mgEcoli 1 mg (E. coli)

Recombinant Brucella Suis ahpD Protein (aa 1-175)

Sign In for Pricing
View Details
Rat Serum amyloid P (SAP) Elisa Kit
EK721230 96 Well

Rat Serum amyloid P (SAP) Elisa Kit

Sign In for Pricing
View Details
FOXF2 (Forkhead Box F2, FKHL6, FREAC2) (APC)
MBS6166768-01 0.1 mL

FOXF2 (Forkhead Box F2, FKHL6, FREAC2) (APC)

Sign In for Pricing
View Details
FOXF2 (Forkhead Box F2, FKHL6, FREAC2) (APC)
MBS6166768-02 5x 0.1 mL

FOXF2 (Forkhead Box F2, FKHL6, FREAC2) (APC)

Sign In for Pricing
View Details
NFKB2 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-9418R-PerCP-Cy5.5 100 µL

NFKB2 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
SCRIB Protein Vector (Rat) (pPM-C-HA)
PV303648 500 ng

SCRIB Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details