Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Basigin/CD147, Cynomolgus (HEK293, His)

Basigin, also called CD147 or EMMPRIN, is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily with homology to both the immunoglobulin V domain and major histocompatibility complex class II antigen -chain. Basigin is the receptor for cyclophilins, S100A9 and platelet glycoprotein VI. Basigin tightly associates with monocarboxylate transporters and is essential for their cell surface translocation and activities [1][2][3]. Basigin/CD147 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Basigin/CD147 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Basigin/CD147 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/basigin-cd147-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

AYGAAGTVSTSVENIGSKTLLTCSLNDSSTEVTGHRWLKGGAVLKEDTLPGQKTDFEVDSDDLGGEYSCVFLPEPTGRADIQLDALLSGAPRVKAVKSSEHVSEGETAVLACKSESLPPVTTWVWYKITDSGDQVIVNGSQGRFFVSSSQGRSELRIENLNMEADPGKYACNGTSSEGTDQATVTLRVRSH

Molecular Formula

102121721 (Gene_ID) XP_005587354 (A19-H209) (Accession)

Molecular Weight

Approximately 27-33 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smco4 (NM_001134584) Rat Tagged ORF Clone Lentiviral Particle
RR212166L3V 200 µL

Smco4 (NM_001134584) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Angiomotin (AMOT) (NM_001113490) Human Tagged ORF Clone
RC226319 10 µg

Angiomotin (AMOT) (NM_001113490) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Quaternary ammonium compound-resistance protein sugE (sugE)
MBS7030622-01 0.02 mg

Recombinant Quaternary ammonium compound-resistance protein sugE (sugE)

Sign In for Pricing
View Details
Recombinant Quaternary ammonium compound-resistance protein sugE (sugE)
MBS7030622-02 0.1 mg

Recombinant Quaternary ammonium compound-resistance protein sugE (sugE)

Sign In for Pricing
View Details
Recombinant Quaternary ammonium compound-resistance protein sugE (sugE)
MBS7030622-03 5x 0.1 mg

Recombinant Quaternary ammonium compound-resistance protein sugE (sugE)

Sign In for Pricing
View Details
Rabbit anti-Ashbya gossypii (strain 10895/CBS 109.51/FGSC 9923/NRRL Y-1056)(Yeast)(Eremothecium gossypii) RPN11 Polyclonal Antibody
MBS7199002 Inquire

Rabbit anti-Ashbya gossypii (strain 10895/CBS 109.51/FGSC 9923/NRRL Y-1056)(Yeast)(Eremothecium gossypii) RPN11 Polyclonal Antibody

Sign In for Pricing
View Details