Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Basigin/CD147, Cynomolgus (HEK293, His)

Basigin, also called CD147 or EMMPRIN, is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily with homology to both the immunoglobulin V domain and major histocompatibility complex class II antigen -chain. Basigin is the receptor for cyclophilins, S100A9 and platelet glycoprotein VI. Basigin tightly associates with monocarboxylate transporters and is essential for their cell surface translocation and activities [1][2][3]. Basigin/CD147 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Basigin/CD147 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Basigin/CD147 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/basigin-cd147-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

AYGAAGTVSTSVENIGSKTLLTCSLNDSSTEVTGHRWLKGGAVLKEDTLPGQKTDFEVDSDDLGGEYSCVFLPEPTGRADIQLDALLSGAPRVKAVKSSEHVSEGETAVLACKSESLPPVTTWVWYKITDSGDQVIVNGSQGRFFVSSSQGRSELRIENLNMEADPGKYACNGTSSEGTDQATVTLRVRSH

Molecular Formula

102121721 (Gene_ID) XP_005587354 (A19-H209) (Accession)

Molecular Weight

Approximately 27-33 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dynll1 Mouse siRNA Oligo Duplex (Locus ID 56455)
SR400732 1 Kit

Dynll1 Mouse siRNA Oligo Duplex (Locus ID 56455)

Sign In for Pricing
View Details
GTDC1 Human shRNA Lentiviral Particle (Locus ID 79712)
TL312580V 500 µL Each

GTDC1 Human shRNA Lentiviral Particle (Locus ID 79712)

Sign In for Pricing
View Details
A431 Calyculin A Control Lysate
MBS657575-01 0.1 mg

A431 Calyculin A Control Lysate

Sign In for Pricing
View Details
A431 Calyculin A Control Lysate
MBS657575-02 5x 0.1 mg

A431 Calyculin A Control Lysate

Sign In for Pricing
View Details
AGTRAP Antibody, FITC conjugated
A58292-100UG 100 µg

AGTRAP Antibody, FITC conjugated

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A Ribosome maturation factor RimM (rimM)
MBS1157606-01 0.02 mg (E-Coli)

Recombinant Salmonella paratyphi A Ribosome maturation factor RimM (rimM)

Sign In for Pricing
View Details