Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Basigin/CD147, Cynomolgus (HEK293, His)

Basigin, also called CD147 or EMMPRIN, is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily with homology to both the immunoglobulin V domain and major histocompatibility complex class II antigen -chain. Basigin is the receptor for cyclophilins, S100A9 and platelet glycoprotein VI. Basigin tightly associates with monocarboxylate transporters and is essential for their cell surface translocation and activities [1][2][3]. Basigin/CD147 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Basigin/CD147 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Basigin/CD147 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/basigin-cd147-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

AYGAAGTVSTSVENIGSKTLLTCSLNDSSTEVTGHRWLKGGAVLKEDTLPGQKTDFEVDSDDLGGEYSCVFLPEPTGRADIQLDALLSGAPRVKAVKSSEHVSEGETAVLACKSESLPPVTTWVWYKITDSGDQVIVNGSQGRFFVSSSQGRSELRIENLNMEADPGKYACNGTSSEGTDQATVTLRVRSH

Molecular Formula

102121721 (Gene_ID) XP_005587354 (A19-H209) (Accession)

Molecular Weight

Approximately 27-33 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal H1F0 Antibody (AE-4) [CoraFluor 1]
NBP2-47753CL1 0.1 mL

Mouse Monoclonal H1F0 Antibody (AE-4) [CoraFluor 1]

Sign In for Pricing
View Details
FGF R4 Recombinant Protein Antigen
NBP1-84585PEP 0.1 mL

FGF R4 Recombinant Protein Antigen

Sign In for Pricing
View Details
Bcdin3d sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6120705 3x 1.0 µg

Bcdin3d sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Rabbit Polyclonal LETMD1 Antibody [mFluor Violet 610 SE]
NBP3-06198MFV610 0.1 mL

Rabbit Polyclonal LETMD1 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
FYTTD1 Over-expression Lysate Product
GWB-4B3351 0.1 mg

FYTTD1 Over-expression Lysate Product

Sign In for Pricing
View Details
Caspase 3 (BSA & Azide Free) (CPP-32, Apoptain, Yama, SCA-1) (Biotin)
MBS6266281-01 0.1 mL

Caspase 3 (BSA & Azide Free) (CPP-32, Apoptain, Yama, SCA-1) (Biotin)

Sign In for Pricing
View Details