Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Basigin/CD147, Cynomolgus (HEK293, His)

Basigin, also called CD147 or EMMPRIN, is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily with homology to both the immunoglobulin V domain and major histocompatibility complex class II antigen -chain. Basigin is the receptor for cyclophilins, S100A9 and platelet glycoprotein VI. Basigin tightly associates with monocarboxylate transporters and is essential for their cell surface translocation and activities [1][2][3]. Basigin/CD147 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Basigin/CD147 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Basigin/CD147 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/basigin-cd147-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

AYGAAGTVSTSVENIGSKTLLTCSLNDSSTEVTGHRWLKGGAVLKEDTLPGQKTDFEVDSDDLGGEYSCVFLPEPTGRADIQLDALLSGAPRVKAVKSSEHVSEGETAVLACKSESLPPVTTWVWYKITDSGDQVIVNGSQGRFFVSSSQGRSELRIENLNMEADPGKYACNGTSSEGTDQATVTLRVRSH

Molecular Formula

102121721 (Gene_ID) XP_005587354 (A19-H209) (Accession)

Molecular Weight

Approximately 27-33 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAGE1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D7]
TA805647BM 100 µL

PAGE1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D7]

Sign In for Pricing
View Details
Recombinant Mycoplasma Capricolum rsmH Protein (aa 1-309)
VAng-Lsx06318-500gEcoli 500 µg (E. coli)

Recombinant Mycoplasma Capricolum rsmH Protein (aa 1-309)

Sign In for Pricing
View Details
Rabbit Polyclonal Calsyntenin-1 Antibody [Janelia Fluor 549]
NBP2-97117JF549 0.1 mL

Rabbit Polyclonal Calsyntenin-1 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
MPV15 M2-1 Protein (N-His, Murine pneumonia virus (strain 15) (MPV) )
P506173 100 µg

MPV15 M2-1 Protein (N-His, Murine pneumonia virus (strain 15) (MPV) )

Sign In for Pricing
View Details
Anti-Cystathionase/CTH Antibody Picoband®, PE Conjugate
PA1556-PE 100 µg/Vial

Anti-Cystathionase/CTH Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
DD-04-038
HY-175601 1 Each

DD-04-038

Sign In for Pricing
View Details