Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Basigin/CD147, Cynomolgus (HEK293, His)

Basigin, also called CD147 or EMMPRIN, is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily with homology to both the immunoglobulin V domain and major histocompatibility complex class II antigen -chain. Basigin is the receptor for cyclophilins, S100A9 and platelet glycoprotein VI. Basigin tightly associates with monocarboxylate transporters and is essential for their cell surface translocation and activities [1][2][3]. Basigin/CD147 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Basigin/CD147 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Basigin/CD147 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/basigin-cd147-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

AYGAAGTVSTSVENIGSKTLLTCSLNDSSTEVTGHRWLKGGAVLKEDTLPGQKTDFEVDSDDLGGEYSCVFLPEPTGRADIQLDALLSGAPRVKAVKSSEHVSEGETAVLACKSESLPPVTTWVWYKITDSGDQVIVNGSQGRFFVSSSQGRSELRIENLNMEADPGKYACNGTSSEGTDQATVTLRVRSH

Molecular Formula

102121721 (Gene_ID) XP_005587354 (A19-H209) (Accession)

Molecular Weight

Approximately 27-33 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Moap1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7145503 1.0 µg DNA

Moap1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
TACC3 Rabbit Monoclonal Antibody
AMRe83705-01 1 Each

TACC3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TACC3 Rabbit Monoclonal Antibody
AMRe83705-02 50 µL

TACC3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TACC3 Rabbit Monoclonal Antibody
AMRe83705-03 100 µL

TACC3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ERK 3 (G-2)
sc-393371 200 µg/mL

ERK 3 (G-2)

Sign In for Pricing
View Details
SuperSignal MaxiSignal Maximum Sensitivity Substrate
36224ES76 500 mL

SuperSignal MaxiSignal Maximum Sensitivity Substrate

Sign In for Pricing
View Details