Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Basigin/CD147, Cynomolgus (HEK293, His)

Basigin, also called CD147 or EMMPRIN, is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily with homology to both the immunoglobulin V domain and major histocompatibility complex class II antigen -chain. Basigin is the receptor for cyclophilins, S100A9 and platelet glycoprotein VI. Basigin tightly associates with monocarboxylate transporters and is essential for their cell surface translocation and activities [1][2][3]. Basigin/CD147 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Basigin/CD147 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Basigin/CD147 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/basigin-cd147-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

AYGAAGTVSTSVENIGSKTLLTCSLNDSSTEVTGHRWLKGGAVLKEDTLPGQKTDFEVDSDDLGGEYSCVFLPEPTGRADIQLDALLSGAPRVKAVKSSEHVSEGETAVLACKSESLPPVTTWVWYKITDSGDQVIVNGSQGRFFVSSSQGRSELRIENLNMEADPGKYACNGTSSEGTDQATVTLRVRSH

Molecular Formula

102121721 (Gene_ID) XP_005587354 (A19-H209) (Accession)

Molecular Weight

Approximately 27-33 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CIAPIN1 Mouse Monoclonal Antibody [Clone ID: OTI1H4]
TA808732 100 µL

CIAPIN1 Mouse Monoclonal Antibody [Clone ID: OTI1H4]

Sign In for Pricing
View Details
FAM100A (Family with Sequence Similarity 100, Member A, FLJ31223, FLJ32185, PP11303) (MaxLight 405) discontinued
245934-ML405 100 µL

FAM100A (Family with Sequence Similarity 100, Member A, FLJ31223, FLJ32185, PP11303) (MaxLight 405) discontinued

Sign In for Pricing
View Details
TCF3 / E2A (TCF3) Human shRNA Plasmid Kit (Locus ID 6929)
TL308904 1 Kit

TCF3 / E2A (TCF3) Human shRNA Plasmid Kit (Locus ID 6929)

Sign In for Pricing
View Details
WDR90 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2636406 1.0 µg DNA

WDR90 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
PAT, Recombinant, Streptomyces Viridochromogenes, aa1-183, His-SUMO-Tag (Phosphinothricin N-acetyltransferase)
374625-01 20 µg

PAT, Recombinant, Streptomyces Viridochromogenes, aa1-183, His-SUMO-Tag (Phosphinothricin N-acetyltransferase)

Sign In for Pricing
View Details
PAT, Recombinant, Streptomyces Viridochromogenes, aa1-183, His-SUMO-Tag (Phosphinothricin N-acetyltransferase)
374625-02 100 µg

PAT, Recombinant, Streptomyces Viridochromogenes, aa1-183, His-SUMO-Tag (Phosphinothricin N-acetyltransferase)

Sign In for Pricing
View Details