Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Basigin/CD147, Cynomolgus (HEK293, His)

Basigin, also called CD147 or EMMPRIN, is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily with homology to both the immunoglobulin V domain and major histocompatibility complex class II antigen -chain. Basigin is the receptor for cyclophilins, S100A9 and platelet glycoprotein VI. Basigin tightly associates with monocarboxylate transporters and is essential for their cell surface translocation and activities [1][2][3]. Basigin/CD147 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Basigin/CD147 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Basigin/CD147 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/basigin-cd147-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

AYGAAGTVSTSVENIGSKTLLTCSLNDSSTEVTGHRWLKGGAVLKEDTLPGQKTDFEVDSDDLGGEYSCVFLPEPTGRADIQLDALLSGAPRVKAVKSSEHVSEGETAVLACKSESLPPVTTWVWYKITDSGDQVIVNGSQGRFFVSSSQGRSELRIENLNMEADPGKYACNGTSSEGTDQATVTLRVRSH

Molecular Formula

102121721 (Gene_ID) XP_005587354 (A19-H209) (Accession)

Molecular Weight

Approximately 27-33 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vipr2 ORF Vector (Rat) (pORF)
49507016 1.0 µg DNA

Vipr2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
PPP2R1A (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
SR303684 2 nmol

PPP2R1A (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Sign In for Pricing
View Details
Probable E3 ubiquitin-protein ligase MID2 (MID2) Human ELISA Kit
G1081 96 Tests

Probable E3 ubiquitin-protein ligase MID2 (MID2) Human ELISA Kit

Sign In for Pricing
View Details
Recombinant Culex quinquefasciatus Adenylate kinase 2, mitochondrial (Adk2)
MBS1222369-01 0.02 mg (E-Coli)

Recombinant Culex quinquefasciatus Adenylate kinase 2, mitochondrial (Adk2)

Sign In for Pricing
View Details
Recombinant Culex quinquefasciatus Adenylate kinase 2, mitochondrial (Adk2)
MBS1222369-02 0.1 mg (E-Coli)

Recombinant Culex quinquefasciatus Adenylate kinase 2, mitochondrial (Adk2)

Sign In for Pricing
View Details
Recombinant Culex quinquefasciatus Adenylate kinase 2, mitochondrial (Adk2)
MBS1222369-03 0.02 mg (Yeast)

Recombinant Culex quinquefasciatus Adenylate kinase 2, mitochondrial (Adk2)

Sign In for Pricing
View Details