Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Basigin/CD147, Cynomolgus (HEK293, His)

Basigin, also called CD147 or EMMPRIN, is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily with homology to both the immunoglobulin V domain and major histocompatibility complex class II antigen -chain. Basigin is the receptor for cyclophilins, S100A9 and platelet glycoprotein VI. Basigin tightly associates with monocarboxylate transporters and is essential for their cell surface translocation and activities [1][2][3]. Basigin/CD147 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Basigin/CD147 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Basigin/CD147 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/basigin-cd147-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

AYGAAGTVSTSVENIGSKTLLTCSLNDSSTEVTGHRWLKGGAVLKEDTLPGQKTDFEVDSDDLGGEYSCVFLPEPTGRADIQLDALLSGAPRVKAVKSSEHVSEGETAVLACKSESLPPVTTWVWYKITDSGDQVIVNGSQGRFFVSSSQGRSELRIENLNMEADPGKYACNGTSSEGTDQATVTLRVRSH

Molecular Formula

102121721 (Gene_ID) XP_005587354 (A19-H209) (Accession)

Molecular Weight

Approximately 27-33 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF16 goat polyclonal antibody, Aff - Purified
PP1103P1 50 µg

FGF16 goat polyclonal antibody, Aff - Purified

Sign In for Pricing
View Details
TTYH1 Rabbit Polyclonal Antibody
TA335497 100 µL

TTYH1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Plant Ribonuclease A3 (RNASE3) ELISA Kit
MBS9379294 Inquire

Plant Ribonuclease A3 (RNASE3) ELISA Kit

Sign In for Pricing
View Details
Donkey ETS Translocation Variant 5 (ETV5) ELISA Kit
MBS9914040 Inquire

Donkey ETS Translocation Variant 5 (ETV5) ELISA Kit

Sign In for Pricing
View Details
Human DC-LAMP Affinity Purified Polyclonal Ab
AF4087-SP 25 µg

Human DC-LAMP Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
ATCAY (Caytaxin, Ataxia Cayman Type Protein, BNIP-2-homolgy, BNIP-H, KIAA1872) (MaxLight 650)
123662-ML650 100 µL

ATCAY (Caytaxin, Ataxia Cayman Type Protein, BNIP-2-homolgy, BNIP-H, KIAA1872) (MaxLight 650)

Sign In for Pricing
View Details