Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Basigin/CD147, Cynomolgus (HEK293, His)

Basigin, also called CD147 or EMMPRIN, is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily with homology to both the immunoglobulin V domain and major histocompatibility complex class II antigen -chain. Basigin is the receptor for cyclophilins, S100A9 and platelet glycoprotein VI. Basigin tightly associates with monocarboxylate transporters and is essential for their cell surface translocation and activities [1][2][3]. Basigin/CD147 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Basigin/CD147 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Basigin/CD147 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/basigin-cd147-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

AYGAAGTVSTSVENIGSKTLLTCSLNDSSTEVTGHRWLKGGAVLKEDTLPGQKTDFEVDSDDLGGEYSCVFLPEPTGRADIQLDALLSGAPRVKAVKSSEHVSEGETAVLACKSESLPPVTTWVWYKITDSGDQVIVNGSQGRFFVSSSQGRSELRIENLNMEADPGKYACNGTSSEGTDQATVTLRVRSH

Molecular Formula

102121721 (Gene_ID) XP_005587354 (A19-H209) (Accession)

Molecular Weight

Approximately 27-33 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIRC35 Protein Vector (Human) (pPB-C-His)
PV111282 500 ng

PIRC35 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
VENTX (Homeobox Protein VENTX, VENT-like Homeobox Protein, NA88A, HPX42B, VENTX2)
319420-01 50 µL

VENTX (Homeobox Protein VENTX, VENT-like Homeobox Protein, NA88A, HPX42B, VENTX2)

Sign In for Pricing
View Details
VENTX (Homeobox Protein VENTX, VENT-like Homeobox Protein, NA88A, HPX42B, VENTX2)
319420-02 100 µL

VENTX (Homeobox Protein VENTX, VENT-like Homeobox Protein, NA88A, HPX42B, VENTX2)

Sign In for Pricing
View Details
Mouse Monoclonal SLA2 Antibody (OTI3A7) [FITC]
NBP2-74210F 0.1 mL

Mouse Monoclonal SLA2 Antibody (OTI3A7) [FITC]

Sign In for Pricing
View Details
Rat Monoclonal ChemR23/CMKLR1 Antibody (BZ194) [Alexa Fluor 594]
NBP3-11985AF594 0.1 mL

Rat Monoclonal ChemR23/CMKLR1 Antibody (BZ194) [Alexa Fluor 594]

Sign In for Pricing
View Details
Mouse Monoclonal PDGF R alpha Antibody (MM0004-8A89) [DyLight 755]
NB110-60969IR 0.1 mL

Mouse Monoclonal PDGF R alpha Antibody (MM0004-8A89) [DyLight 755]

Sign In for Pricing
View Details