Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Basigin/CD147, Cynomolgus (HEK293, His)

Basigin, also called CD147 or EMMPRIN, is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily with homology to both the immunoglobulin V domain and major histocompatibility complex class II antigen -chain. Basigin is the receptor for cyclophilins, S100A9 and platelet glycoprotein VI. Basigin tightly associates with monocarboxylate transporters and is essential for their cell surface translocation and activities [1][2][3]. Basigin/CD147 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Basigin/CD147 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Basigin/CD147 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/basigin-cd147-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

AYGAAGTVSTSVENIGSKTLLTCSLNDSSTEVTGHRWLKGGAVLKEDTLPGQKTDFEVDSDDLGGEYSCVFLPEPTGRADIQLDALLSGAPRVKAVKSSEHVSEGETAVLACKSESLPPVTTWVWYKITDSGDQVIVNGSQGRFFVSSSQGRSELRIENLNMEADPGKYACNGTSSEGTDQATVTLRVRSH

Molecular Formula

102121721 (Gene_ID) XP_005587354 (A19-H209) (Accession)

Molecular Weight

Approximately 27-33 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

slingshot homolog 3 (SSH3)(MBP-his tagged)-50
AR09-P0024-50 50ug

slingshot homolog 3 (SSH3)(MBP-his tagged)-50

Sign In for Pricing
View Details
DNASE1L3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV677564 1.0 µg DNA

DNASE1L3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
ASTM Method D2887-06a Fuel Oil Degradation/Retention Time Mix C17-C20, 4 components
F871861 1 mL

ASTM Method D2887-06a Fuel Oil Degradation/Retention Time Mix C17-C20, 4 components

Sign In for Pricing
View Details
ATP6V1B2 (V-type Proton ATPase Subunit B, Brain Isoform, V-ATPase Subunit B 2, Endomembrane Proton Pump 58kD Subunit, HO57, Vacuolar Proton Pump Subunit B 2, ATP6B2, VPP3) (MaxLight 550)
123726-ML550 100 µL

ATP6V1B2 (V-type Proton ATPase Subunit B, Brain Isoform, V-ATPase Subunit B 2, Endomembrane Proton Pump 58kD Subunit, HO57, Vacuolar Proton Pump Subunit B 2, ATP6B2, VPP3) (MaxLight 550)

Sign In for Pricing
View Details
Cathepsin F (CTSF) Antibody
abx111444 100 µL

Cathepsin F (CTSF) Antibody

Sign In for Pricing
View Details
MRPL52 (NM_178336) Human Tagged ORF Clone Lentiviral Particle
RC209661L4V 200 µL

MRPL52 (NM_178336) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details