Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Basigin/CD147, Cynomolgus (HEK293, His)

Basigin, also called CD147 or EMMPRIN, is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily with homology to both the immunoglobulin V domain and major histocompatibility complex class II antigen -chain. Basigin is the receptor for cyclophilins, S100A9 and platelet glycoprotein VI. Basigin tightly associates with monocarboxylate transporters and is essential for their cell surface translocation and activities [1][2][3]. Basigin/CD147 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Basigin/CD147 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Basigin/CD147 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/basigin-cd147-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

AYGAAGTVSTSVENIGSKTLLTCSLNDSSTEVTGHRWLKGGAVLKEDTLPGQKTDFEVDSDDLGGEYSCVFLPEPTGRADIQLDALLSGAPRVKAVKSSEHVSEGETAVLACKSESLPPVTTWVWYKITDSGDQVIVNGSQGRFFVSSSQGRSELRIENLNMEADPGKYACNGTSSEGTDQATVTLRVRSH

Molecular Formula

102121721 (Gene_ID) XP_005587354 (A19-H209) (Accession)

Molecular Weight

Approximately 27-33 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Human CD40 HT1080 Cell Line
S01YF-0123-KX350 1 Vial

Magic™ Human CD40 HT1080 Cell Line

Sign In for Pricing
View Details
Trim46 siRNA Oligos set (Rat)
47792176 3x 5 nmol

Trim46 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Recombinant Klebsiella Pneumoniae lacY Protein (aa 1-111)
VAng-Cr5022-1mgEcoli 1 mg (E. coli)

Recombinant Klebsiella Pneumoniae lacY Protein (aa 1-111)

Sign In for Pricing
View Details
Lentiviral human CYREN shRNA (UAS) - Lentiviral human CYREN shRNA (UAS) (100)
GTR15138726 1 Vial

Lentiviral human CYREN shRNA (UAS) - Lentiviral human CYREN shRNA (UAS) (100)

Sign In for Pricing
View Details
Pla2g6 (NM_001005560) Rat Tagged ORF Clone Lentiviral Particle
RR206825L3V 200 µL

Pla2g6 (NM_001005560) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Poglut1 sgRNA CRISPR Lentivector set (Rat)
K7579301 3x 1.0 µg

Poglut1 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details