Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Basigin/CD147, Cynomolgus (HEK293, His)

Basigin, also called CD147 or EMMPRIN, is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily with homology to both the immunoglobulin V domain and major histocompatibility complex class II antigen -chain. Basigin is the receptor for cyclophilins, S100A9 and platelet glycoprotein VI. Basigin tightly associates with monocarboxylate transporters and is essential for their cell surface translocation and activities [1][2][3]. Basigin/CD147 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Basigin/CD147 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Basigin/CD147 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/basigin-cd147-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

AYGAAGTVSTSVENIGSKTLLTCSLNDSSTEVTGHRWLKGGAVLKEDTLPGQKTDFEVDSDDLGGEYSCVFLPEPTGRADIQLDALLSGAPRVKAVKSSEHVSEGETAVLACKSESLPPVTTWVWYKITDSGDQVIVNGSQGRFFVSSSQGRSELRIENLNMEADPGKYACNGTSSEGTDQATVTLRVRSH

Molecular Formula

102121721 (Gene_ID) XP_005587354 (A19-H209) (Accession)

Molecular Weight

Approximately 27-33 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLFNL1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D4]
TA501884AM 100 µL

SLFNL1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D4]

Sign In for Pricing
View Details
ICP Std Holmium 10000ug/mL in 2-5% HNO3 - 250ML
PHO4B2 250 mL

ICP Std Holmium 10000ug/mL in 2-5% HNO3 - 250ML

Sign In for Pricing
View Details
Rabbit Polyclonal PEX11B Antibody
NBP3-17415-25ul 25 µL

Rabbit Polyclonal PEX11B Antibody

Sign In for Pricing
View Details
Quininib
463375-01 1 mg

Quininib

Sign In for Pricing
View Details
Quininib
463375-02 2.5 mg

Quininib

Sign In for Pricing
View Details
EPMIP Rabbit Polyclonal Antibody
MBS9514396-01 0.05 mL

EPMIP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details