Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Basigin/CD147, Cynomolgus (HEK293, His)

Basigin, also called CD147 or EMMPRIN, is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily with homology to both the immunoglobulin V domain and major histocompatibility complex class II antigen -chain. Basigin is the receptor for cyclophilins, S100A9 and platelet glycoprotein VI. Basigin tightly associates with monocarboxylate transporters and is essential for their cell surface translocation and activities [1][2][3]. Basigin/CD147 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Basigin/CD147 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Basigin/CD147 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/basigin-cd147-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

AYGAAGTVSTSVENIGSKTLLTCSLNDSSTEVTGHRWLKGGAVLKEDTLPGQKTDFEVDSDDLGGEYSCVFLPEPTGRADIQLDALLSGAPRVKAVKSSEHVSEGETAVLACKSESLPPVTTWVWYKITDSGDQVIVNGSQGRFFVSSSQGRSELRIENLNMEADPGKYACNGTSSEGTDQATVTLRVRSH

Molecular Formula

102121721 (Gene_ID) XP_005587354 (A19-H209) (Accession)

Molecular Weight

Approximately 27-33 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

E2F7 Human siRNA Oligo Duplex (Locus ID 144455)
SR315484 1 Kit

E2F7 Human siRNA Oligo Duplex (Locus ID 144455)

Sign In for Pricing
View Details
Waterproof CRYO-GRIP® GLOVE MidArm, MED, Blue
1464289 1 PC

Waterproof CRYO-GRIP® GLOVE MidArm, MED, Blue

Sign In for Pricing
View Details
Mouse Monoclonal CD68/SR-D1 Antibody (OTI1E6) [Alexa Fluor 750]
NBP2-70381AF750 0.1 mL

Mouse Monoclonal CD68/SR-D1 Antibody (OTI1E6) [Alexa Fluor 750]

Sign In for Pricing
View Details
CORO1B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV660559 1.0 µg DNA

CORO1B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
MHC Class II I-Abd Mouse Monoclonal Antibody [Clone ID: 28-16-8S]
CL067B 100 µg

MHC Class II I-Abd Mouse Monoclonal Antibody [Clone ID: 28-16-8S]

Sign In for Pricing
View Details
Rad51ap1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4901203 1.0 µg DNA

Rad51ap1 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details