Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Basigin/CD147, Cynomolgus (HEK293, His)

Basigin, also called CD147 or EMMPRIN, is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily with homology to both the immunoglobulin V domain and major histocompatibility complex class II antigen -chain. Basigin is the receptor for cyclophilins, S100A9 and platelet glycoprotein VI. Basigin tightly associates with monocarboxylate transporters and is essential for their cell surface translocation and activities [1][2][3]. Basigin/CD147 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Basigin/CD147 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Basigin/CD147 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/basigin-cd147-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

AYGAAGTVSTSVENIGSKTLLTCSLNDSSTEVTGHRWLKGGAVLKEDTLPGQKTDFEVDSDDLGGEYSCVFLPEPTGRADIQLDALLSGAPRVKAVKSSEHVSEGETAVLACKSESLPPVTTWVWYKITDSGDQVIVNGSQGRFFVSSSQGRSELRIENLNMEADPGKYACNGTSSEGTDQATVTLRVRSH

Molecular Formula

102121721 (Gene_ID) XP_005587354 (A19-H209) (Accession)

Molecular Weight

Approximately 27-33 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTL6A, Recombinant, aa1-429 (Actin-like Protein 6A, 53kD BRG1-associated Factor A, Actin-related Protein Baf53a, ArpNbeta, BRG1-associated Factor 53A, BAF53A) discontinued
149790 50 µg

ACTL6A, Recombinant, aa1-429 (Actin-like Protein 6A, 53kD BRG1-associated Factor A, Actin-related Protein Baf53a, ArpNbeta, BRG1-associated Factor 53A, BAF53A) discontinued

Sign In for Pricing
View Details
TRIP6 (Thyroid Receptor Interacting Protein 6, Thyroid Hormone Receptor Interactor 6, Thyroid Receptor-interacting Protein 6, TRI6, TRIP 6, TRIP-6, MGC10556, MGC10558, MGC29959, MGC3837, MGC4423, OIP 1, OIP1, OIP-1, OPA-interacting Protein 1, Zyxin-related Protein 1, ZRP 1, ZRP1, ZRP-1) (PE)
134779-PE 100 µL

TRIP6 (Thyroid Receptor Interacting Protein 6, Thyroid Hormone Receptor Interactor 6, Thyroid Receptor-interacting Protein 6, TRI6, TRIP 6, TRIP-6, MGC10556, MGC10558, MGC29959, MGC3837, MGC4423, OIP 1, OIP1, OIP-1, OPA-interacting Protein 1, Zyxin-related Protein 1, ZRP 1, ZRP1, ZRP-1) (PE)

Sign In for Pricing
View Details
RPL8, CT (RPL8, 60S ribosomal protein L8) (Biotin) discontinued
041218-Biotin 200 µL

RPL8, CT (RPL8, 60S ribosomal protein L8) (Biotin) discontinued

Sign In for Pricing
View Details
P53 (Tumor Suppressor Protein, Oncogene Protein)
P1001-32Z 100 µg

P53 (Tumor Suppressor Protein, Oncogene Protein)

Sign In for Pricing
View Details
Active Vitamin A & Vitamin E & Rosehip Liposome Complex
CLP-029 1 Kg

Active Vitamin A & Vitamin E & Rosehip Liposome Complex

Sign In for Pricing
View Details
pNeoEGFP Plasmid
PVT29744 2 µg

pNeoEGFP Plasmid

Sign In for Pricing
View Details