Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Basigin/CD147, Cynomolgus (HEK293, His)

Basigin, also called CD147 or EMMPRIN, is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily with homology to both the immunoglobulin V domain and major histocompatibility complex class II antigen -chain. Basigin is the receptor for cyclophilins, S100A9 and platelet glycoprotein VI. Basigin tightly associates with monocarboxylate transporters and is essential for their cell surface translocation and activities [1][2][3]. Basigin/CD147 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Basigin/CD147 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Basigin/CD147 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/basigin-cd147-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

AYGAAGTVSTSVENIGSKTLLTCSLNDSSTEVTGHRWLKGGAVLKEDTLPGQKTDFEVDSDDLGGEYSCVFLPEPTGRADIQLDALLSGAPRVKAVKSSEHVSEGETAVLACKSESLPPVTTWVWYKITDSGDQVIVNGSQGRFFVSSSQGRSELRIENLNMEADPGKYACNGTSSEGTDQATVTLRVRSH

Molecular Formula

102121721 (Gene_ID) XP_005587354 (A19-H209) (Accession)

Molecular Weight

Approximately 27-33 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Bend4 shRNA (UAS) - Lentiviral mouse Bend4 shRNA (UAS, iRFP) plasmid
GTR15267436 1 Vial

Lentiviral mouse Bend4 shRNA (UAS) - Lentiviral mouse Bend4 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal antibody to PAN3 (PAN3 poly(A) specific ribonuclease subunit homolog (S. cerevisiae))
TA308082 100 µL

Rabbit Polyclonal antibody to PAN3 (PAN3 poly(A) specific ribonuclease subunit homolog (S. cerevisiae))

Sign In for Pricing
View Details
Sephs2 Mouse qPCR Primer Pair (NM_009266)
MP215113 200 Reactions

Sephs2 Mouse qPCR Primer Pair (NM_009266)

Sign In for Pricing
View Details
SMTN CRISPRa sgRNA lentivector (set of three targets)(Human)
44480121 3x 1.0µg DNA

SMTN CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Eukaryotic Human Lysyl Oxidase (LOX)
RPU58862-01 50 µg

Eukaryotic Human Lysyl Oxidase (LOX)

Sign In for Pricing
View Details
Eukaryotic Human Lysyl Oxidase (LOX)
RPU58862-02 100 µg

Eukaryotic Human Lysyl Oxidase (LOX)

Sign In for Pricing
View Details