Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Basigin/CD147, Cynomolgus (HEK293, His)

Basigin, also called CD147 or EMMPRIN, is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily with homology to both the immunoglobulin V domain and major histocompatibility complex class II antigen -chain. Basigin is the receptor for cyclophilins, S100A9 and platelet glycoprotein VI. Basigin tightly associates with monocarboxylate transporters and is essential for their cell surface translocation and activities [1][2][3]. Basigin/CD147 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Basigin/CD147 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Basigin/CD147 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/basigin-cd147-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

AYGAAGTVSTSVENIGSKTLLTCSLNDSSTEVTGHRWLKGGAVLKEDTLPGQKTDFEVDSDDLGGEYSCVFLPEPTGRADIQLDALLSGAPRVKAVKSSEHVSEGETAVLACKSESLPPVTTWVWYKITDSGDQVIVNGSQGRFFVSSSQGRSELRIENLNMEADPGKYACNGTSSEGTDQATVTLRVRSH

Molecular Formula

102121721 (Gene_ID) XP_005587354 (A19-H209) (Accession)

Molecular Weight

Approximately 27-33 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goose Zinc Finger Protein Pegasus (IKZF5) ELISA Kit
MBS9940616 Inquire

Goose Zinc Finger Protein Pegasus (IKZF5) ELISA Kit

Sign In for Pricing
View Details
ST2 (IL1RL1) (NM_016232) Human Tagged Lenti ORF Clone
RC217503L3 10 µg

ST2 (IL1RL1) (NM_016232) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
C16orf79 Protein Vector (Human) (pPB-His-GST)
PV329187 500 ng

C16orf79 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
TBN Std 70mg/g KOH in Synth Oil - 100G
RETBN70R 100 g

TBN Std 70mg/g KOH in Synth Oil - 100G

Sign In for Pricing
View Details
ZNF648 (NM_001009992) Human Tagged ORF Clone
RG220260 10 µg

ZNF648 (NM_001009992) Human Tagged ORF Clone

Sign In for Pricing
View Details
Integrin alphaV, beta6 (APC)
MBS6242249-01 0.1 mL

Integrin alphaV, beta6 (APC)

Sign In for Pricing
View Details