Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Basigin/CD147, Cynomolgus (HEK293, His)

Basigin, also called CD147 or EMMPRIN, is a transmembrane glycoprotein that belongs to the immunoglobulin superfamily with homology to both the immunoglobulin V domain and major histocompatibility complex class II antigen -chain. Basigin is the receptor for cyclophilins, S100A9 and platelet glycoprotein VI. Basigin tightly associates with monocarboxylate transporters and is essential for their cell surface translocation and activities [1][2][3]. Basigin/CD147 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Basigin/CD147 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Basigin/CD147 Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/basigin-cd147-protein-cynomolgus-hek293-his.html

Purity

97.0

Smiles

AYGAAGTVSTSVENIGSKTLLTCSLNDSSTEVTGHRWLKGGAVLKEDTLPGQKTDFEVDSDDLGGEYSCVFLPEPTGRADIQLDALLSGAPRVKAVKSSEHVSEGETAVLACKSESLPPVTTWVWYKITDSGDQVIVNGSQGRFFVSSSQGRSELRIENLNMEADPGKYACNGTSSEGTDQATVTLRVRSH

Molecular Formula

102121721 (Gene_ID) XP_005587354 (A19-H209) (Accession)

Molecular Weight

Approximately 27-33 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

mPEG2-OH
MD001002-2-01 10 g

mPEG2-OH

Sign In for Pricing
View Details
mPEG2-OH
MD001002-2-02 25 g

mPEG2-OH

Sign In for Pricing
View Details
BAX (BAX, BCL2L4, Apoptosis regulator BAX, Bcl-2-like protein 4) (Azide free) (HRP) discontinued
030802-HRP 200 µL

BAX (BAX, BCL2L4, Apoptosis regulator BAX, Bcl-2-like protein 4) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Human Aldolase C, Fructose Bisphosphate (ALDOC) ELISA Kit
MBS457542-01 48 Tests

Human Aldolase C, Fructose Bisphosphate (ALDOC) ELISA Kit

Sign In for Pricing
View Details
Human Aldolase C, Fructose Bisphosphate (ALDOC) ELISA Kit
MBS457542-02 96 Tests

Human Aldolase C, Fructose Bisphosphate (ALDOC) ELISA Kit

Sign In for Pricing
View Details
Human Aldolase C, Fructose Bisphosphate (ALDOC) ELISA Kit
MBS457542-03 5x 96 Tests

Human Aldolase C, Fructose Bisphosphate (ALDOC) ELISA Kit

Sign In for Pricing
View Details