Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD58 Recombinant Protein

CD58 Recombinant Protein

Product Specifications

UniProt

P19256

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~24kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSG SLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHY NSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPS SGHSRHR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ORC3L (ORC3) (NM_012381) Human Tagged Lenti ORF Clone
RC218245L3 10 µg

ORC3L (ORC3) (NM_012381) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PHF11 (PHD Finger Protein 11, APY, BCAP, IGEL, IGER, IGHER, NYREN34, NY-REN-34) (MaxLight 490)
MBS6431452-01 0.1 mL

PHF11 (PHD Finger Protein 11, APY, BCAP, IGEL, IGER, IGHER, NYREN34, NY-REN-34) (MaxLight 490)

Sign In for Pricing
View Details
PHF11 (PHD Finger Protein 11, APY, BCAP, IGEL, IGER, IGHER, NYREN34, NY-REN-34) (MaxLight 490)
MBS6431452-02 5x 0.1 mL

PHF11 (PHD Finger Protein 11, APY, BCAP, IGEL, IGER, IGHER, NYREN34, NY-REN-34) (MaxLight 490)

Sign In for Pricing
View Details
RPL36AP33 siRNA Oligos set (Human)
41560171 3x 5 nmol

RPL36AP33 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Recombinant Tragelaphus oryx Cytochrome c oxidase subunit 3 (MT-CO3)
MBS7021757-01 0.02 mg

Recombinant Tragelaphus oryx Cytochrome c oxidase subunit 3 (MT-CO3)

Sign In for Pricing
View Details
Recombinant Tragelaphus oryx Cytochrome c oxidase subunit 3 (MT-CO3)
MBS7021757-02 0.1 mg

Recombinant Tragelaphus oryx Cytochrome c oxidase subunit 3 (MT-CO3)

Sign In for Pricing
View Details