Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD305 Recombinant Protein

CD305 Recombinant Protein

Product Specifications

UniProt

Q6GTX8

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~20kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

QEEDLPRPSISAEPGTVIPLGSHVTFVCRGPVGVQTFRLERESRSTYNDTEDVSQASPSE SEARFRIDSVSEGNAGPYRCIYYKPPKWSEQSDYLELLVKETSGGPDSPDTEPGSSAGPT QRPSDNSHNEHAPASQGLKAEHLY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASSP3 CRISPR All-in-one AAV vector set (with saCas9)(Human)
53059151 3x 1.0 µg DNA

ASSP3 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
NANOG (S285) (NANOG, Homeobox protein NANOG, Homeobox transcription factor Nanog) (Biotin)
MBS6323673-01 0.2 mL

NANOG (S285) (NANOG, Homeobox protein NANOG, Homeobox transcription factor Nanog) (Biotin)

Sign In for Pricing
View Details
NANOG (S285) (NANOG, Homeobox protein NANOG, Homeobox transcription factor Nanog) (Biotin)
MBS6323673-02 5x 0.2 mL

NANOG (S285) (NANOG, Homeobox protein NANOG, Homeobox transcription factor Nanog) (Biotin)

Sign In for Pricing
View Details
SEC13 (Protein SEC13 Homolog, SEC13-like Protein 1, SEC13-related Protein, D3S1231E, SEC13L1, SEC13R) (APC)
133078-APC 100 µL

SEC13 (Protein SEC13 Homolog, SEC13-like Protein 1, SEC13-related Protein, D3S1231E, SEC13L1, SEC13R) (APC)

Sign In for Pricing
View Details
Rat Aggrecan (AGC) ELISA Kit
DL-AGC-Ra-01 48 Tests

Rat Aggrecan (AGC) ELISA Kit

Sign In for Pricing
View Details
Rat Aggrecan (AGC) ELISA Kit
DL-AGC-Ra-02 96 Tests

Rat Aggrecan (AGC) ELISA Kit

Sign In for Pricing
View Details