CD2 Recombinant Protein
CD2 Recombinant Protein
Product Specifications
UniProt
P06729
Tag
His-tag
Field of Research
Immunology & Inflammation
Solubility
PBS, 4M Urea, PH7.4
Molecular Weight
~26kDa
Storage Conditions
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Notes
For research use only.
Preservative
PBS, 4M Urea, pH 7.4
AA Sequence
KEITNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQFRKEKETFKEKDTY KLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEKIFDLKIQERVSKPKISWTCINTTL TCEVMNGTDPELNLYQDGKHLKLSQRVITHKWTTSLSAKFKCTAGNKVSKESSVEPVSCP EKGLD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![NADH Dehydrogenase Fe-S Protein 4, CT (NADH Dehydrogenase [Ubiquinone] Iron-sulfur Protein 4 Mitochondrial, NDUFS4, AQDQ, Complex I-18kD, CI-18kD, Complex I-AQDQ, CI-AQDQ, NADH-ubiquinone Oxidoreductase 18kD Subunit)](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
N0009-41C 200 µL
NADH Dehydrogenase Fe-S Protein 4, CT (NADH Dehydrogenase [Ubiquinone] Iron-sulfur Protein 4 Mitochondrial, NDUFS4, AQDQ, Complex I-18kD, CI-18kD, Complex I-AQDQ, CI-AQDQ, NADH-ubiquinone Oxidoreductase 18kD Subunit)
Sign In for Pricing
View Details 
MBS2509844-01 24 Tests (Limit 1)
Human CCL4L1 (Chemokine C-C-Motif Ligand 4 Like Protein 1) ELISA Kit
Sign In for Pricing
View Details MBS2509844-02 48 Tests
Human CCL4L1 (Chemokine C-C-Motif Ligand 4 Like Protein 1) ELISA Kit
Sign In for Pricing
View Details MBS2509844-03 96 Tests
Human CCL4L1 (Chemokine C-C-Motif Ligand 4 Like Protein 1) ELISA Kit
Sign In for Pricing
View Details MBS2509844-04 5x 96 Tests
Human CCL4L1 (Chemokine C-C-Motif Ligand 4 Like Protein 1) ELISA Kit
Sign In for Pricing
View Details MBS2509844-05 10x 96 Tests
Human CCL4L1 (Chemokine C-C-Motif Ligand 4 Like Protein 1) ELISA Kit
Sign In for Pricing
View Details