What is the catalog number for CD277 Recombinant Protein?

The catalog number for CD277 Recombinant Protein is orb1088577.

What sizes are available for CD277 Recombinant Protein?

CD277 Recombinant Protein is available in the following size(s): 500 µg, 1 mg.

How many pack sizes does CD277 Recombinant Protein come in?

CD277 Recombinant Protein is available in 2 different pack sizes.

Is CD277 Recombinant Protein in stock?

CD277 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

CD277 Recombinant Protein

Product Specifications

UniProt

O00481

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~24kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQ SAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSD LHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVI MRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YLD5195-01 50 µL

Rabbit anti-MSH6 Antibody

Sign In for Pricing

View Details

YLD5195-02 100 µL

Rabbit anti-MSH6 Antibody

Sign In for Pricing

View Details

093695-01 50 Kg

Ferrous Sulphide Fused Sticks 95.0% for Producing H2S

Sign In for Pricing

View Details

093695-02 1 kg

Ferrous Sulphide Fused Sticks 95.0% for Producing H2S

Sign In for Pricing

View Details

A14259-1-Dylight550 100 µg

Anti-SSSCA1/ZNRD2 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing

View Details

TR516884 1 Kit

Olfr724 Mouse shRNA Plasmid (Locus ID 258485)

Sign In for Pricing

View Details