What is the catalog number for CD277 Recombinant Protein?

The catalog number for CD277 Recombinant Protein is orb1088577.

What sizes are available for CD277 Recombinant Protein?

CD277 Recombinant Protein is available in the following size(s): 500 µg, 1 mg.

How many pack sizes does CD277 Recombinant Protein come in?

CD277 Recombinant Protein is available in 2 different pack sizes.

Is CD277 Recombinant Protein in stock?

CD277 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

CD277 Recombinant Protein

Product Specifications

UniProt

O00481

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~24kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQ SAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSD LHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVI MRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OM637308-01 100 µL

C-Kit [ST04-99] Antibody

Sign In for Pricing

View Details

OM637308-02 20 µL

C-Kit [ST04-99] Antibody

Sign In for Pricing

View Details

OM637308-03 50 µL

C-Kit [ST04-99] Antibody

Sign In for Pricing

View Details

MR218492 10 µg

Tcn2 (NM_001130459) Mouse Tagged ORF Clone

Sign In for Pricing

View Details

ARP42041_P050-25UL 25 µL

MMP3 Antibody - middle region

Sign In for Pricing

View Details

E45H00837-2 20 µg

GPR17 (NM_001161416) Human Over-expression Lysate

Sign In for Pricing

View Details