What is the catalog number for CD277 Recombinant Protein?

The catalog number for CD277 Recombinant Protein is orb1088577.

What sizes are available for CD277 Recombinant Protein?

CD277 Recombinant Protein is available in the following size(s): 500 µg, 1 mg.

How many pack sizes does CD277 Recombinant Protein come in?

CD277 Recombinant Protein is available in 2 different pack sizes.

Is CD277 Recombinant Protein in stock?

CD277 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

CD277 Recombinant Protein

Product Specifications

UniProt

O00481

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~24kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQ SAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSD LHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVI MRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-47752DL594 0.1 mL

Mouse Monoclonal Histone H1 Antibody (1415-1) [DyLight 594]

Sign In for Pricing

View Details

HP204072 200 Reactions

GLOD5 Human qPCR Primer Pair (NM_001080489)

Sign In for Pricing

View Details

GTR15252313 1 Vial

Lentiviral mouse Ccdc69 shRNA (UAS) - Lentiviral mouse Ccdc69 shRNA (UAS, RFP) plasmid

Sign In for Pricing

View Details

MR208102L3 10 µg

Plk3 (BC031180) Mouse Tagged Lenti ORF Clone

Sign In for Pricing

View Details

K0008606 1.0 µg DNA

S100A9 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing

View Details

UB-GEN-17138 100 µL

Mouse Anti-Human CD32 mAb (AF647)

Sign In for Pricing

View Details