What is the catalog number for CD89 Recombinant Protein?

The catalog number for CD89 Recombinant Protein is orb1088576.

What sizes are available for CD89 Recombinant Protein?

CD89 Recombinant Protein is available in the following size(s): 500 µg, 1 mg.

How many pack sizes does CD89 Recombinant Protein come in?

CD89 Recombinant Protein is available in 2 different pack sizes.

Is CD89 Recombinant Protein in stock?

CD89 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

CD89 Recombinant Protein

Product Specifications

UniProt

P24071

Tag

His-tag

Field of Research

Immunology & Inflammation

Solubility

PBS, 4M Urea, PH7.4

Molecular Weight

~23kDa

Storage Conditions

Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Notes

For research use only.

Preservative

PBS, 4M Urea, pH 7.4

AA Sequence

QEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNET DPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGEN ISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSP YLWSFPSNALELVVTDSIHQDYTTQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AF7129-BP 1 mg

Phospho-KIF1B (Ser1057) Peptide

Sign In for Pricing

View Details

C-BETB002-500mL 500 mL

Sephadex G25, 500mL

Sign In for Pricing

View Details

E56G2312 100 µL

Calnexin Rabbit Monoclonal Antibody

Sign In for Pricing

View Details

orb469694 100 µL

Notch1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing

View Details

sc-96204-SH 20 µg

ANKRD33 shRNA Plasmid (h)

Sign In for Pricing

View Details

K3186308 1.0 µg DNA

Snrpf sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing

View Details