Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-18BP, Mouse (HEK293, His)

IL-18BP protein regulates immune processes by binding to interleukin-18 (IL-18), inhibiting its activity. This interaction positions IL-18BP as a key inhibitor of the early TH1 cytokine response, emphasizing its role in immune modulation and potential contribution to regulating inflammatory responses. IL-18BP Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-18BP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-18BP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-18bp-protein-mouse-193a-a-hek293-his.html

Purity

95.00

Smiles

TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA

Molecular Formula

16068 (Gene_ID) Q9Z0M9/NP_034661.1 (T29-A193) (Accession)

Molecular Weight

Approximately 32-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chd7 Rat shRNA Lentiviral Particle (Locus ID 312974)
TL706453V 500 µL Each

Chd7 Rat shRNA Lentiviral Particle (Locus ID 312974)

Sign In for Pricing
View Details
C8orf47 (ERICH5) (NM_173549) Human Tagged ORF Clone Lentiviral Particle
RC209102L4V 200 µL

C8orf47 (ERICH5) (NM_173549) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
AKT2 Rat Monoclonal Antibody [Clone ID: 16G11.A7]
TA319557 100 µg

AKT2 Rat Monoclonal Antibody [Clone ID: 16G11.A7]

Sign In for Pricing
View Details
CD30 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-42266R-BF405 100 µL

CD30 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Afap1 3'UTR GFP Stable Cell Line
TU250363 1.0 mL

Afap1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Pyrococcus abyssi UPF0127 protein PYRAB11210 (PYRAB11210)
MBS1296888-01 0.02 mg (E-Coli)

Recombinant Pyrococcus abyssi UPF0127 protein PYRAB11210 (PYRAB11210)

Sign In for Pricing
View Details