Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-18BP, Mouse (HEK293, His)

IL-18BP protein regulates immune processes by binding to interleukin-18 (IL-18), inhibiting its activity. This interaction positions IL-18BP as a key inhibitor of the early TH1 cytokine response, emphasizing its role in immune modulation and potential contribution to regulating inflammatory responses. IL-18BP Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-18BP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-18BP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-18bp-protein-mouse-193a-a-hek293-his.html

Purity

95.00

Smiles

TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA

Molecular Formula

16068 (Gene_ID) Q9Z0M9/NP_034661.1 (T29-A193) (Accession)

Molecular Weight

Approximately 32-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-WNK1 Antibody (N391/68)
RHJ57001 100 μg

Anti-WNK1 Antibody (N391/68)

Sign In for Pricing
View Details
APC anti-human CD133
GT16417 25 Tests

APC anti-human CD133

Sign In for Pricing
View Details
Rabbit Polyclonal xCT Antibody [Janelia Fluor 585]
NB300-317JF585 0.1 mL

Rabbit Polyclonal xCT Antibody [Janelia Fluor 585]

Sign In for Pricing
View Details
UBR7 3'UTR Lenti-reporter-Luc Vector
49051081 1.0 µg

UBR7 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
ZAK (MAP3K20) (NM_016653) Human Untagged Clone
SC114182 10 µg

ZAK (MAP3K20) (NM_016653) Human Untagged Clone

Sign In for Pricing
View Details
L-Selectin Polyclonal Antibody
RA26935-01 50 µL

L-Selectin Polyclonal Antibody

Sign In for Pricing
View Details