Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-18BP, Mouse (HEK293, His)

IL-18BP protein regulates immune processes by binding to interleukin-18 (IL-18), inhibiting its activity. This interaction positions IL-18BP as a key inhibitor of the early TH1 cytokine response, emphasizing its role in immune modulation and potential contribution to regulating inflammatory responses. IL-18BP Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-18BP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-18BP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-18bp-protein-mouse-193a-a-hek293-his.html

Purity

95.00

Smiles

TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA

Molecular Formula

16068 (Gene_ID) Q9Z0M9/NP_034661.1 (T29-A193) (Accession)

Molecular Weight

Approximately 32-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD117 (C-kit) (ABT233) Antibody
W0272-01 20 µL

CD117 (C-kit) (ABT233) Antibody

Sign In for Pricing
View Details
CD117 (C-kit) (ABT233) Antibody
W0272-02 40 µL

CD117 (C-kit) (ABT233) Antibody

Sign In for Pricing
View Details
CD117 (C-kit) (ABT233) Antibody
W0272-03 100 µL

CD117 (C-kit) (ABT233) Antibody

Sign In for Pricing
View Details
CD117 (C-kit) (ABT233) Antibody
W0272-04 200 µL

CD117 (C-kit) (ABT233) Antibody

Sign In for Pricing
View Details
Recombinant Moraxella catarrhalis Beta-lactamase BRO-1 (bla)
MBS1400325-01 0.02 mg (E-Coli)

Recombinant Moraxella catarrhalis Beta-lactamase BRO-1 (bla)

Sign In for Pricing
View Details
Recombinant Moraxella catarrhalis Beta-lactamase BRO-1 (bla)
MBS1400325-02 0.02 mg (Yeast)

Recombinant Moraxella catarrhalis Beta-lactamase BRO-1 (bla)

Sign In for Pricing
View Details