Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-18BP, Mouse (HEK293, His)

IL-18BP protein regulates immune processes by binding to interleukin-18 (IL-18), inhibiting its activity. This interaction positions IL-18BP as a key inhibitor of the early TH1 cytokine response, emphasizing its role in immune modulation and potential contribution to regulating inflammatory responses. IL-18BP Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-18BP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-18BP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-18bp-protein-mouse-193a-a-hek293-his.html

Purity

95.00

Smiles

TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA

Molecular Formula

16068 (Gene_ID) Q9Z0M9/NP_034661.1 (T29-A193) (Accession)

Molecular Weight

Approximately 32-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- (2-Bromoacetamido) -2,2,5,5-tetramethyl-1-pyrrolidinyloxy, Free Radical
sc-209445 25 mg

3- (2-Bromoacetamido) -2,2,5,5-tetramethyl-1-pyrrolidinyloxy, Free Radical

Sign In for Pricing
View Details
Recombinant Clostridium Botulinum mutS Protein (aa 1-932) (strain Loch Maree / Type A3)
VAng-Lsx8356-inquire Inquire

Recombinant Clostridium Botulinum mutS Protein (aa 1-932) (strain Loch Maree / Type A3)

Sign In for Pricing
View Details
SIAE Protein Vector (Human) (pPM-C-HA)
PV038047 500 ng

SIAE Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Tasosartan 10mM * 1mL in DMSO
A10891-10mM-D 10 mM x 1mL in DMSO

Tasosartan 10mM * 1mL in DMSO

Sign In for Pricing
View Details
Human Retinoschisin (RS) ELISA Kit
EKN48218 96 Tests

Human Retinoschisin (RS) ELISA Kit

Sign In for Pricing
View Details
Brd4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6580007 1.0 µg DNA

Brd4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details