Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-18BP, Mouse (HEK293, His)

IL-18BP protein regulates immune processes by binding to interleukin-18 (IL-18), inhibiting its activity. This interaction positions IL-18BP as a key inhibitor of the early TH1 cytokine response, emphasizing its role in immune modulation and potential contribution to regulating inflammatory responses. IL-18BP Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-18BP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-18BP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-18bp-protein-mouse-193a-a-hek293-his.html

Purity

95.00

Smiles

TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA

Molecular Formula

16068 (Gene_ID) Q9Z0M9/NP_034661.1 (T29-A193) (Accession)

Molecular Weight

Approximately 32-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-2Rα ELISA Kit
SEKH-0009-01 48 Tests

Human IL-2Rα ELISA Kit

Sign In for Pricing
View Details
Human IL-2Rα ELISA Kit
SEKH-0009-02 96 Tests

Human IL-2Rα ELISA Kit

Sign In for Pricing
View Details
MBD3 Blocking Peptide
MBS9614840-01 1 mg

MBD3 Blocking Peptide

Sign In for Pricing
View Details
MBD3 Blocking Peptide
MBS9614840-02 5x 1 mg

MBD3 Blocking Peptide

Sign In for Pricing
View Details
Cesium Chloride (trace metal basis) AR
103500 100 100 g

Cesium Chloride (trace metal basis) AR

Sign In for Pricing
View Details
IL8 (Interleukin 8, CXCL8, GCP-1, GCP1, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1) (APC)
247633-APC 100 µL

IL8 (Interleukin 8, CXCL8, GCP-1, GCP1, LECT, LUCT, LYNAP, MDNCF, MONAP, NAF, NAP-1, NAP1) (APC)

Sign In for Pricing
View Details