Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-18BP, Mouse (HEK293, His)

IL-18BP protein regulates immune processes by binding to interleukin-18 (IL-18), inhibiting its activity. This interaction positions IL-18BP as a key inhibitor of the early TH1 cytokine response, emphasizing its role in immune modulation and potential contribution to regulating inflammatory responses. IL-18BP Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-18BP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-18BP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-18bp-protein-mouse-193a-a-hek293-his.html

Purity

95.00

Smiles

TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA

Molecular Formula

16068 (Gene_ID) Q9Z0M9/NP_034661.1 (T29-A193) (Accession)

Molecular Weight

Approximately 32-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lung
CR560778 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
RHPN2 siRNA Oligos set (Human)
39569171 3x 5 nmol

RHPN2 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Active Recombinant Monkey BTLA Protein, Fc-tagged, FITC conjugated
BTLA-195CF 20 μg- 50 μg- 100 μg

Active Recombinant Monkey BTLA Protein, Fc-tagged, FITC conjugated

Sign In for Pricing
View Details
Recombinant Campylobacter Jejuni valS Protein (aa 1-870) (strain RM1221)
VAng-Ly2996-inquire Inquire

Recombinant Campylobacter Jejuni valS Protein (aa 1-870) (strain RM1221)

Sign In for Pricing
View Details
SFRS12IP1 (SREK1IP1) Human shRNA Lentiviral Particle (Locus ID 285672)
TL307755V 500 µL Each

SFRS12IP1 (SREK1IP1) Human shRNA Lentiviral Particle (Locus ID 285672)

Sign In for Pricing
View Details
TALK-2 Polyclonal Antibody
BT-AP08818-01 20 µL

TALK-2 Polyclonal Antibody

Sign In for Pricing
View Details