Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-18BP, Mouse (HEK293, His)

IL-18BP protein regulates immune processes by binding to interleukin-18 (IL-18), inhibiting its activity. This interaction positions IL-18BP as a key inhibitor of the early TH1 cytokine response, emphasizing its role in immune modulation and potential contribution to regulating inflammatory responses. IL-18BP Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-18BP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-18BP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-18bp-protein-mouse-193a-a-hek293-his.html

Purity

95.00

Smiles

TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA

Molecular Formula

16068 (Gene_ID) Q9Z0M9/NP_034661.1 (T29-A193) (Accession)

Molecular Weight

Approximately 32-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant R. sanguineus Evasin-3 His-tag Protein CF
10034-EV-050 50 µg

Recombinant R. sanguineus Evasin-3 His-tag Protein CF

Sign In for Pricing
View Details
Rabbit Anti-LRRC67 antibody
SL18400R-01 50 µL

Rabbit Anti-LRRC67 antibody

Sign In for Pricing
View Details
Rabbit Anti-LRRC67 antibody
SL18400R-02 100 µL

Rabbit Anti-LRRC67 antibody

Sign In for Pricing
View Details
SACM1L (NM_014016) Human Over-expression Lysate
LH08990V 100 µg

SACM1L (NM_014016) Human Over-expression Lysate

Sign In for Pricing
View Details
Myoglobin, Recombinant, Human, Western Blot Control (MB, MGC13548, Parvalbumin, PVALB)
MBS635595-01 0.01 mg

Myoglobin, Recombinant, Human, Western Blot Control (MB, MGC13548, Parvalbumin, PVALB)

Sign In for Pricing
View Details
Myoglobin, Recombinant, Human, Western Blot Control (MB, MGC13548, Parvalbumin, PVALB)
MBS635595-02 5x 0.01 mg

Myoglobin, Recombinant, Human, Western Blot Control (MB, MGC13548, Parvalbumin, PVALB)

Sign In for Pricing
View Details