Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-18BP, Mouse (HEK293, His)

IL-18BP protein regulates immune processes by binding to interleukin-18 (IL-18), inhibiting its activity. This interaction positions IL-18BP as a key inhibitor of the early TH1 cytokine response, emphasizing its role in immune modulation and potential contribution to regulating inflammatory responses. IL-18BP Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-18BP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-18BP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-18bp-protein-mouse-193a-a-hek293-his.html

Purity

95.00

Smiles

TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA

Molecular Formula

16068 (Gene_ID) Q9Z0M9/NP_034661.1 (T29-A193) (Accession)

Molecular Weight

Approximately 32-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IFN-alpha C (alpha 10)
11120-1 1x 10^5 U

Recombinant Human IFN-alpha C (alpha 10)

Sign In for Pricing
View Details
Nori® Bovine 2-Plex ELISA Kits-MMP9/MMP10
GR228161 96 Well

Nori® Bovine 2-Plex ELISA Kits-MMP9/MMP10

Sign In for Pricing
View Details
Rabbit anti-Human CYP27B1 Polyclonal Antibody
MBS7137157-01 0.05 mL

Rabbit anti-Human CYP27B1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Human CYP27B1 Polyclonal Antibody
MBS7137157-02 0.1 mL

Rabbit anti-Human CYP27B1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Human CYP27B1 Polyclonal Antibody
MBS7137157-03 5x 0.1 mL

Rabbit anti-Human CYP27B1 Polyclonal Antibody

Sign In for Pricing
View Details
Cadherin 6, NT (K-Cadherin, Kidney Cadherin, CDH6, Cadherin-6) (MaxLight 490)
MBS6466377-01 0.1 mL

Cadherin 6, NT (K-Cadherin, Kidney Cadherin, CDH6, Cadherin-6) (MaxLight 490)

Sign In for Pricing
View Details