Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-18BP, Mouse (HEK293, His)

IL-18BP protein regulates immune processes by binding to interleukin-18 (IL-18), inhibiting its activity. This interaction positions IL-18BP as a key inhibitor of the early TH1 cytokine response, emphasizing its role in immune modulation and potential contribution to regulating inflammatory responses. IL-18BP Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-18BP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-18BP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-18bp-protein-mouse-193a-a-hek293-his.html

Purity

95.00

Smiles

TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA

Molecular Formula

16068 (Gene_ID) Q9Z0M9/NP_034661.1 (T29-A193) (Accession)

Molecular Weight

Approximately 32-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ecamsule Triethanolamine
sc-497375 100 mg

Ecamsule Triethanolamine

Sign In for Pricing
View Details
HMGN1L1 3'UTR Luciferase Stable Cell Line
TU009984 1.0 mL

HMGN1L1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Biotinylated Anti-CD38 antibody (EN028) ; Rabbit mAb
E33E100027B 100 µL

Biotinylated Anti-CD38 antibody (EN028) ; Rabbit mAb

Sign In for Pricing
View Details
DUSP15 Protein Vector (Rat) (pPB-N-His)
PV265067 500 ng

DUSP15 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
7,8-Dihydroxyflavone, TrkB agonist/neurotrophic
TBI1174-100MG 100 mg

7,8-Dihydroxyflavone, TrkB agonist/neurotrophic

Sign In for Pricing
View Details
VPREB1 Blocking Peptide
MBS9628615-01 1 mg

VPREB1 Blocking Peptide

Sign In for Pricing
View Details