Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-18BP, Mouse (HEK293, His)

IL-18BP protein regulates immune processes by binding to interleukin-18 (IL-18), inhibiting its activity. This interaction positions IL-18BP as a key inhibitor of the early TH1 cytokine response, emphasizing its role in immune modulation and potential contribution to regulating inflammatory responses. IL-18BP Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-18BP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-18BP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-18bp-protein-mouse-193a-a-hek293-his.html

Purity

95.00

Smiles

TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA

Molecular Formula

16068 (Gene_ID) Q9Z0M9/NP_034661.1 (T29-A193) (Accession)

Molecular Weight

Approximately 32-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Dermcidin (DCD) ELISA Kit
EKN44810-01 48 Tests

Rat Dermcidin (DCD) ELISA Kit

Sign In for Pricing
View Details
Rat Dermcidin (DCD) ELISA Kit
EKN44810-02 96 Tests

Rat Dermcidin (DCD) ELISA Kit

Sign In for Pricing
View Details
Rat Dermcidin (DCD) ELISA Kit
EKN44810-03 5x 96 Tests

Rat Dermcidin (DCD) ELISA Kit

Sign In for Pricing
View Details
RGD1561552 ORF Vector (Rat) (pORF)
39252016 1.0 µg DNA

RGD1561552 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
C2orf18 3'UTR Luciferase Stable Cell Line
TU002174 1.0 mL

C2orf18 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Porcine Transcription Factor A, Mitochondrial ELISA Kit
MBS089384-01 48 Well

Porcine Transcription Factor A, Mitochondrial ELISA Kit

Sign In for Pricing
View Details