Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-18BP, Mouse (HEK293, His)

IL-18BP protein regulates immune processes by binding to interleukin-18 (IL-18), inhibiting its activity. This interaction positions IL-18BP as a key inhibitor of the early TH1 cytokine response, emphasizing its role in immune modulation and potential contribution to regulating inflammatory responses. IL-18BP Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-18BP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-18BP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-18bp-protein-mouse-193a-a-hek293-his.html

Purity

95.00

Smiles

TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA

Molecular Formula

16068 (Gene_ID) Q9Z0M9/NP_034661.1 (T29-A193) (Accession)

Molecular Weight

Approximately 32-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD69 Antibody (8B6)
NBP1-51607-0.025mL 0.025 mL

Mouse Monoclonal CD69 Antibody (8B6)

Sign In for Pricing
View Details
Metomidate Hydrochloride
456160 25 mg

Metomidate Hydrochloride

Sign In for Pricing
View Details
o-Phenylphenol Glucuronide
TRC-P336125-100MG 100 mg

o-Phenylphenol Glucuronide

Sign In for Pricing
View Details
ZNF625 Human qPCR Primer Pair (NM_145233)
HP217414 200 Reactions

ZNF625 Human qPCR Primer Pair (NM_145233)

Sign In for Pricing
View Details
Lentiviral human TPD52 sgRNA gene knockout kit - Lentiviral human TPD52 sgRNA gene knockout kit (25)
GTR15387435 1 Vial

Lentiviral human TPD52 sgRNA gene knockout kit - Lentiviral human TPD52 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
APIP Antibody - N-terminal region
MBS3213001-01 0.1 mL

APIP Antibody - N-terminal region

Sign In for Pricing
View Details