Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-18BP, Mouse (HEK293, His)

IL-18BP protein regulates immune processes by binding to interleukin-18 (IL-18), inhibiting its activity. This interaction positions IL-18BP as a key inhibitor of the early TH1 cytokine response, emphasizing its role in immune modulation and potential contribution to regulating inflammatory responses. IL-18BP Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-18BP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-18BP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-18bp-protein-mouse-193a-a-hek293-his.html

Purity

95.00

Smiles

TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA

Molecular Formula

16068 (Gene_ID) Q9Z0M9/NP_034661.1 (T29-A193) (Accession)

Molecular Weight

Approximately 32-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL12RB1 (Interleukin-12 Receptor Subunit beta-1, IL-12 Receptor Subunit beta-1, IL-12R Subunit beta-1, IL-12R-beta-1, IL-12RB1, IL-12 Receptor beta Component, CD212, IL12R, IL12RB, MGC34454) (HRP)
MBS6382556-01 0.1 mL

IL12RB1 (Interleukin-12 Receptor Subunit beta-1, IL-12 Receptor Subunit beta-1, IL-12R Subunit beta-1, IL-12R-beta-1, IL-12RB1, IL-12 Receptor beta Component, CD212, IL12R, IL12RB, MGC34454) (HRP)

Sign In for Pricing
View Details
IL12RB1 (Interleukin-12 Receptor Subunit beta-1, IL-12 Receptor Subunit beta-1, IL-12R Subunit beta-1, IL-12R-beta-1, IL-12RB1, IL-12 Receptor beta Component, CD212, IL12R, IL12RB, MGC34454) (HRP)
MBS6382556-02 5x 0.1 mL

IL12RB1 (Interleukin-12 Receptor Subunit beta-1, IL-12 Receptor Subunit beta-1, IL-12R Subunit beta-1, IL-12R-beta-1, IL-12RB1, IL-12 Receptor beta Component, CD212, IL12R, IL12RB, MGC34454) (HRP)

Sign In for Pricing
View Details
CD21 (CR2) (NM_001006658) Human Tagged Lenti ORF Clone
RC212485L4 10 µg

CD21 (CR2) (NM_001006658) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
NOS1AP, ID (NOS1AP, CAPON, KIAA0464, Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein, C-terminal PDZ ligand of neuronal nitric oxide synthase protein, Nitric oxide synthase 1 adaptor protein) (PE)
MBS6326015-01 0.2 mL

NOS1AP, ID (NOS1AP, CAPON, KIAA0464, Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein, C-terminal PDZ ligand of neuronal nitric oxide synthase protein, Nitric oxide synthase 1 adaptor protein) (PE)

Sign In for Pricing
View Details
NOS1AP, ID (NOS1AP, CAPON, KIAA0464, Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein, C-terminal PDZ ligand of neuronal nitric oxide synthase protein, Nitric oxide synthase 1 adaptor protein) (PE)
MBS6326015-02 5x 0.2 mL

NOS1AP, ID (NOS1AP, CAPON, KIAA0464, Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein, C-terminal PDZ ligand of neuronal nitric oxide synthase protein, Nitric oxide synthase 1 adaptor protein) (PE)

Sign In for Pricing
View Details
Lentiviral human NEURL1 sgRNA gene knockout kit - Lentiviral human NEURL1 sgRNA gene knockout kit (plasmid)
GTR15392528 1 Vial

Lentiviral human NEURL1 sgRNA gene knockout kit - Lentiviral human NEURL1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details