Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-18BP, Mouse (HEK293, His)

IL-18BP protein regulates immune processes by binding to interleukin-18 (IL-18), inhibiting its activity. This interaction positions IL-18BP as a key inhibitor of the early TH1 cytokine response, emphasizing its role in immune modulation and potential contribution to regulating inflammatory responses. IL-18BP Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-18BP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-18BP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-18bp-protein-mouse-193a-a-hek293-his.html

Purity

95.00

Smiles

TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA

Molecular Formula

16068 (Gene_ID) Q9Z0M9/NP_034661.1 (T29-A193) (Accession)

Molecular Weight

Approximately 32-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CAMSAP1L1 Antibody [Alexa Fluor 647]
NBP1-21401AF647 0.1 mL

Rabbit Polyclonal CAMSAP1L1 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Mouse Aldosterone Synthase (ALDOS) ELISA Kit
RDR-ALDOS-Mu-48Tests 48 Tests

Mouse Aldosterone Synthase (ALDOS) ELISA Kit

Sign In for Pricing
View Details
BTF3a/b Lentiviral Activation Particles (m)
sc-432305-LAC 200 µL

BTF3a/b Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Recombinant Rat CTBP2 Protein, His (Fc)-Avi-tagged
CTBP2-1308R 50 µg

Recombinant Rat CTBP2 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
HIST1H2AG (Ab-74) Antibody
A77719-50UL 50 μL

HIST1H2AG (Ab-74) Antibody

Sign In for Pricing
View Details
Rat Secreted Frizzled Related Protein 1 (SFRP1) ELISA Kit
RDR-SFRP1-Ra-01 96 Tests

Rat Secreted Frizzled Related Protein 1 (SFRP1) ELISA Kit

Sign In for Pricing
View Details