Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-18BP, Mouse (HEK293, His)

IL-18BP protein regulates immune processes by binding to interleukin-18 (IL-18), inhibiting its activity. This interaction positions IL-18BP as a key inhibitor of the early TH1 cytokine response, emphasizing its role in immune modulation and potential contribution to regulating inflammatory responses. IL-18BP Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-18BP protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-18BP Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-18bp-protein-mouse-193a-a-hek293-his.html

Purity

95.00

Smiles

TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA

Molecular Formula

16068 (Gene_ID) Q9Z0M9/NP_034661.1 (T29-A193) (Accession)

Molecular Weight

Approximately 32-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Slc25a12 qPCR Primer Pair
QM46362S 200 Tests

Mouse Slc25a12 qPCR Primer Pair

Sign In for Pricing
View Details
MGMT Polyclonal Antibody
ABP51789-01 30 µL

MGMT Polyclonal Antibody

Sign In for Pricing
View Details
MGMT Polyclonal Antibody
ABP51789-02 100 µL

MGMT Polyclonal Antibody

Sign In for Pricing
View Details
MGMT Polyclonal Antibody
ABP51789-03 200 µL

MGMT Polyclonal Antibody

Sign In for Pricing
View Details
PCDHGA5 (Protocadherin gamma-A5, PCDH-gamma-A5, ME3, PCDH-GAMMA-A5, MGC142020) (MaxLight 750)
MBS6234378-01 0.1 mL

PCDHGA5 (Protocadherin gamma-A5, PCDH-gamma-A5, ME3, PCDH-GAMMA-A5, MGC142020) (MaxLight 750)

Sign In for Pricing
View Details
PCDHGA5 (Protocadherin gamma-A5, PCDH-gamma-A5, ME3, PCDH-GAMMA-A5, MGC142020) (MaxLight 750)
MBS6234378-02 5x 0.1 mL

PCDHGA5 (Protocadherin gamma-A5, PCDH-gamma-A5, ME3, PCDH-GAMMA-A5, MGC142020) (MaxLight 750)

Sign In for Pricing
View Details