Animal-Free BDNF, Human (His)

Brain Derived Neurotrophic Factor (BDNF) is a neurotrophin that belongs to NGF-beta family. BDNF can bind to its high affinity receptor TrkB and activates signal transduction cascades (IRS1/2, PI3K, Akt) [1]. BDNF can also bind to the p75NTR, but the affinity for the p75NTR receptor is lower than for TrkB[2]. BDNF is a neurotransmitter modulator, and is vital in maturation, survival and differentiation of neuronal populations during development. BDNF also participates in neuronal plasticity, which is essential for learning and memory. BDNF is widely expressed in the CNS[1]. Animal-Free BDNF Protein, Human/Mouse (His) is an animal-free recombinant human/muose BDNF (H129-R247) with C-terminal His tag, which is produced in E.coli.This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free BDNF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-bdnf-protein-human-mouse-his.html

Purity

98.0

Smiles

MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Molecular Formula

627 (Gene_ID) P23560-1 (H129-R247) (Accession)

Molecular Weight

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Bathina S, et al. Brain-derived neurotrophic factor and its clinical implications. Arch Med Sci. 2015 Dec 10;11 (6) :1164-78.|[2]Lima Giacobbo B, et al. Brain-Derived Neurotrophic Factor in Brain Disorders: Focus on Neuroinflammation. Mol Neurobiol. 2019 May;56 (5) :3295-3312.|[3]Egan MF, et al. The BDNF val66met polymorphism affects activity-dependent secretion of BDNF and human memory and hippocampal function. Cell. 2003 Jan 24;112 (2) :257-69.|[4]Alonso M, et al. Signaling mechanisms mediating BDNF modulation of memory formation in vivo in the hippocampus. Cell Mol Neurobiol. 2002 Dec;22 (5-6) :663-74.